KEGG   Pan troglodytes (chimpanzee): 460060Help
Entry
460060            CDS       T01005                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04371  Apelin signaling pathway
ptr05034  Alcoholism
ptr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    460060 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    460060 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    460060 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    460060 (HDAC4)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     460060 (HDAC4)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     460060 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 460060
NCBI-ProteinID: XP_009442955
Ensembl: ENSPTRG00000013097
VGNC: 1957
UniProt: K7CKK4
LinkDB All DBs
Position
2B
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVAAALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQAL
LDEPYLDRLPGQKEAHAQAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKIL
IVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGY
LTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccgcggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caagagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcgcgcccaccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcacgagaaggctcggcc
gctccacttcccctctacacgtcgccatccctgcccaacatcacgctgggcctgcctgcc
accggcccctctgctggcacggcgggccagcaggacgccgagagactcgcccttcccgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctccacgcacagtccttggttggtgcagaccgggtgtccccctccatccacaag
ctgcggcagcaccgcccactggggcggacccagtcggccccgctgccccagaacgcccag
gctctgcagcacctggtcatccagcagcagcatcagcagtttctggagaaacacaagcag
cagttccagcagcagcaactgcagatgaacaagatcatccccaagccaagcgagccagcc
cggcagccggagagccacccggaggagacggaggaggagctccgtgagcaccaggctctg
ctggacgagccctacctggaccggctgccggggcagaaggaggcgcacgcacaggccggc
gtgcaggtgaagcaggagcccattgagagcgatgacgaagaggcagagcccccacgggag
gtggagccaggccagcgccagcccagtgagcaggagctgctcttcagacagcaagccctc
ctgctggagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggccgcc
ggcatccccgtgtccttcggcggccacaggcctctgtcccgggcgcagtcctcacccgcg
tctgccaccttccccgtgtctgtgcaggagccccccaccaagccgaggttcacgacaggc
ctcgtgtatgacacgctgatgctgaagcaccagtgcacctgcgggagcagcagcagccac
cccgagcacgccgggaggatccagagcatctggtcccgcctgcaggagacgggcctccgg
ggcaaatgcgagtgcatccgcggacgcaaggccaccctggaggagctacagacggtgcac
tcggaagcccacaccctcctgtatggcacgaaccccctcaaccggcagaaactggacagt
aagaaacttctaggctcgctcgcctccgtgttcgtccggctcccctgcggtggtgttggg
gtggacagtgacaccatatggaacgaggtgcactcggcgggggcagcccgcctggctgtg
ggctgcgtggtagagctggtcttcaaggtggccacgggggagctgaagaatggctttgct
gtggtccgcccccctggacaccatgcggaggagagcacgcccatgggcttttgctacttc
aactccgtggccgtggcagccaagcttctgcagcagaggttgagcgtgagcaagatcctc
atcgtggactgggacgtgcaccatggaaacgggacccagcaggctttctacagcgacccc
agcgtcctgtacgtgtccctccaccgctacgacgatgggaacttcttcccaggcagcggg
gctcctgatgaggtgggcacagggcccggcgtgggtttcaacgtcaacatggctttcacc
ggcggcctggacccccccatgggagacgctgagtacttggcggccttcagaacggtggtc
atgccgatcgccagcgagtttgccccggatgtggtgctggtgtcatcaggcttcgacgcc
gtggagggccaccccacccctcttgggggctacaacctctccgccagatgcttcgggtac
ctgacgaagcagctgatgggcctggctggcggccggatcgtcctggccctcgagggaggc
cacgacctgaccgccatttgcgacgcctcggaagcatgtgtttctgccttgctgggaaac
gagcttgatcctctcccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgt
tccatggagaaagtcatggagatccacagcaagtactggcgctgcctgcagcgcacaacc
tccacagcggggcgttctctgatcgaggctcagacttgcgagaacgaagaagccgagacg
gtcaccgccatggcctcgctgtccgtgggcgtgaagcccgccgaaaagagaccagatgag
gagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system