KEGG   Pan troglodytes (chimpanzee): 460158
Entry
460158            CDS       T01005                                 

Gene name
IL17RE
Definition
(RefSeq) interleukin-17 receptor E isoform X1
  KO
K05168  interleukin 17 receptor E
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    460158 (IL17RE)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    460158 (IL17RE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptr04050]
    460158 (IL17RE)
Cytokine receptors [BR:ptr04050]
 Interleukin receptor families
  IL17 receptor family
   460158 (IL17RE)
SSDB
Motif
Pfam: IL17_R_N SEFIR
Other DBs
NCBI-GeneID: 460158
NCBI-ProteinID: XP_009443146
Ensembl: ENSPTRG00000014602
VGNC: 6295
LinkDB
Position
3
AA seq 673 aa
MGSSRPAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTVRCRCQDDSFTGSSAH
IPCRTSWALFSTKPWCVRVWHCSRCLCQHLLSGRSGLQRGLFHLLVQKSKKSSTFKFYRR
HKMPAPAQRKLLPRRHLSEKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRH
GGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELP
YEFLLPCLCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYSQHTQMVMALTLR
CPLKLEAALCQRHDWHTLCKDLPNATARESDGWYVLEKVDLHPQLCFKFSFGNSSHVECP
HQTGSLTSWNVSMDTQAQQLILHFSSRMHATFSAAWSLPGLGQDTLVPPVYTVSQARGSS
PVTLDLIIPFLRPGCCVLVWRSDVQFAWKHLLCPDVSYRHLGLLILALLALLTLLGVVLA
LTCRRPQSGPGPARPVLLLHAADSEAQRRLVGALAELLRAALGGGRDVIVDLWEGRHVAR
VGPLPWLWAARARVAREQGTVLLLWSGADLLPVSGPDPRAAPLLALLHAAPRPLLLLAYF
SRLCAKGDIPPPLRALPRYRLLRDLPRLLRALDARPFAEATSWGRPGARQRRQSRLELCS
RLEREAARLADLG
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggggagctccagaccggcagccctgctcctgcctctcctcctcatagtcatcgacctc
tctgactctgctgggattggctttcgccacctgccccactggaacacccgctgtcctctg
gcctcccacacagtaaggtgccgctgccaggatgacagtttcactggaagttctgcccat
atcccttgccgcacctcgtgggccctcttctccacaaagccttggtgtgtgcgagtctgg
cactgttcccgctgtttgtgccagcatctgctgtcaggtcgctcaggtcttcaacggggc
ctcttccacctcctggtgcagaaatccaaaaagtcttccacattcaagttctataggaga
cacaagatgccagcacctgctcagaggaagctgctgcctcgtcgtcacctgtctgagaag
agccatcacatttccatcccctccccagacatctcccacaagggacttcgctctaaaagg
acccaaccttcggatccagagacatgggaaagtcttcccagattggactcacaaaggcat
ggaggacccgagttctcctttgatttgctgcctgaggcccgggctattcgggtgaccata
tcttcaggccctgaggtcagcgtgcgtctttgtcaccagtgggcactggagtgtgaagag
ctgagcagtccctatgatgtccagaaaattgtgtctgggggccacactgtagagctgcct
tatgaattccttctgccctgtctgtgcatagaggcatcctacctgcaagaggacactgtg
aggcgcaaaaaatgtcccttccagagctggccagaagcctatggctcggacttctggaag
tcagtgcacttcactgactacagccagcacactcagatggtcatggccctgacactccgc
tgcccactgaagctggaagctgccctctgccagaggcatgactggcataccctttgcaaa
gacctcccgaatgccacggctcgagagtcagacgggtggtatgttttggagaaggtggac
ctgcacccccagctctgcttcaagttctcttttggaaacagcagccatgttgaatgcccc
caccagactgggtctctcacatcctggaatgtaagcatggatacccaagcccagcagctg
attcttcacttctcctcaagaatgcatgccaccttcagtgctgcctggagcctcccaggc
ttggggcaggacactttggtgccccccgtgtacactgtcagccaggcccggggctcaagc
ccagtgacactagacctcatcattcccttcctgaggccagggtgctgtgttctggtgtgg
cggtcagatgtccagtttgcctggaagcacctcttgtgtccggatgtctcttacagacac
ctggggctcttgatcctggcactgctggccctcctcaccctactgggtgttgttctggcc
ctcacctgccggcgcccacagtcaggcccgggcccagcgcggccagtgctcctcctgcac
gcggcggactcggaggcgcagcggcgcctggtgggagcgctggctgaactgctacgggca
gcgctgggcggcgggcgcgacgtgatcgtggacctgtgggaggggaggcacgtggcgcgc
gtgggcccgctgccgtggctctgggcggcgcgggcgcgcgtagcgcgggagcagggcact
gtgctgctgctgtggagtggcgccgaccttctcccggtcagcggccccgacccccgcgcc
gcgcccctgctcgccctgctccacgctgccccgcgcccgctgctgctgctcgcttacttc
agtcgcctctgcgccaagggcgacatccccccgccgctgcgcgccctgccgcgctaccgc
ctgctgcgcgacctgccgcgcctgctgcgggcgctggacgcgcggcctttcgcagaggcc
accagctggggccgccctggggcgcggcagcgcaggcagagccgcctagagctgtgcagc
cggctcgaacgagaggccgcccgacttgcagacctaggttga

DBGET integrated database retrieval system