KEGG   Pan troglodytes (chimpanzee): 460243
Entry
460243            CDS       T01005                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04068  FoxO signaling pathway
ptr04144  Endocytosis
ptr04218  Cellular senescence
ptr04350  TGF-beta signaling pathway
ptr04380  Osteoclast differentiation
ptr04390  Hippo signaling pathway
ptr04520  Adherens junction
ptr04659  Th17 cell differentiation
ptr04926  Relaxin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05142  Chagas disease
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    460243 (TGFBR2)
   04350 TGF-beta signaling pathway
    460243 (TGFBR2)
   04390 Hippo signaling pathway
    460243 (TGFBR2)
   04068 FoxO signaling pathway
    460243 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    460243 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    460243 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    460243 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    460243 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    460243 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    460243 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    460243 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    460243 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    460243 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    460243 (TGFBR2)
   05212 Pancreatic cancer
    460243 (TGFBR2)
   05225 Hepatocellular carcinoma
    460243 (TGFBR2)
   05226 Gastric cancer
    460243 (TGFBR2)
   05220 Chronic myeloid leukemia
    460243 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    460243 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    460243 (TGFBR2)
   05161 Hepatitis B
    460243 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    460243 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    460243 (TGFBR2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     460243 (TGFBR2)
Protein kinases [BR:ptr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   460243 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 460243
NCBI-ProteinID: XP_001166647
Ensembl: ENSPTRG00000014711
VGNC: 9701
UniProt: A0A6D2WDV1 H2QZF5
LinkDB
Position
3
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctattgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatatttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacag
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
cttcacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagat
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system