KEGG   Pan troglodytes (chimpanzee): 461318
Entry
461318            CDS       T01005                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04144  Endocytosis
ptr04151  PI3K-Akt signaling pathway
ptr04510  Focal adhesion
ptr04540  Gap junction
ptr04630  JAK-STAT signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr05163  Human cytomegalovirus infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    461318 (PDGFRA)
   04014 Ras signaling pathway
    461318 (PDGFRA)
   04015 Rap1 signaling pathway
    461318 (PDGFRA)
   04630 JAK-STAT signaling pathway
    461318 (PDGFRA)
   04020 Calcium signaling pathway
    461318 (PDGFRA)
   04072 Phospholipase D signaling pathway
    461318 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    461318 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    461318 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    461318 (PDGFRA)
   04540 Gap junction
    461318 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    461318 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    461318 (PDGFRA)
   05206 MicroRNAs in cancer
    461318 (PDGFRA)
   05230 Central carbon metabolism in cancer
    461318 (PDGFRA)
   05231 Choline metabolism in cancer
    461318 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    461318 (PDGFRA)
   05218 Melanoma
    461318 (PDGFRA)
   05215 Prostate cancer
    461318 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    461318 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    461318 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    461318 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    461318 (PDGFRA)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     461318 (PDGFRA)
Protein kinases [BR:ptr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   461318 (PDGFRA)
CD molecules [BR:ptr04090]
 Proteins
  461318 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 461318
NCBI-ProteinID: XP_016807215
UniProt: H2QPH4
LinkDB
Position
4
AA seq 1102 aa
MGFAETIRKFPRAMGTSHPAFLVLSCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSL
RCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQT
EENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGV
VPASYNSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKS
GETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGD
YECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRI
SWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTF
ELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILAN
NVSNIITEIHPRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLS
EIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgggcttcgcggagaccattaggaagtttcccagagctatggggacttcccatccggcg
ttcctggtcttaagctgtcttctcacagggctgagcctaatcctctgccagctttcatta
ccctctatccttccaaatgaaaatgaaaaggttgtgcagctgaattcatccttttctctg
agatgctttggggagagtgaagtgagctggcagtaccccatgtctgaagaagagagctcc
gatgtggaaatcagaaatgaagaaaacaacagcggcctttttgtgacggtcttggaagtg
agcagtgcctcggcggcccacacagggttgtacacttgctattacaaccacactcagaca
gaagagaatgagcttgaaggcaggcacatttacatctatgtgccagacccagatgtagcc
tttgtacctctaggaatgacggattatttagtcatcgtggaggatgatgattctgccatt
ataccttgtcgcacaactgatcccgagactcctgtaaccttacacaacagtgagggggtg
gtacctgcctcctacaacagcagacagggctttaatgggaccttcactgtagggccctat
atctgtgaggccaccgtcaaaggaaagaagttccagaccatcccatttaacgtttatgct
ttaaaagcaacatcagagctggatctagaaatggaagctcttaaaaccgtgtataagtca
ggggaaacgattgtggtcacctgtgctgtttttaacaatgaggtggttgaccttcaatgg
acttaccctggagaagtgaaaggcaaaggcatcacaatgctggaagaaatcaaagtccca
tccatcaaattggtgtacactttgacggtccccgaggccacggtgaaagacagtggagat
tacgaatgtgctgcccgccaggctaccagggaggtcaaagaaatgaagaaagtcactatt
tctgtccatgagaaagggttcattgaaatcaaacccaccttcagccagttggaagctgtc
aacctgcatgaagtcaaacattttgttgtagaggtgcgggcctacccacctcccaggata
tcctggctgaaaaacaatctgactctgattgaaaatctcactgagatcaccactgatgtg
gaaaagattcaggaaataaggtatcgaagcaaattaaagctgatccgtgctaaggaagaa
gacagtggccattatactattgtagctcaaaatgaagatgctgtgaagagctatactttt
gaactgttaactcaagttccttcatccattctggacttggtcgatgatcaccacggctca
actgggggacagacggtgaggtgcacagctgaaggcacgccgcttcctgatattgagtgg
atgatatgcaaggatattaagaaatgtaataatgaaacttcctggacgattttggccaac
aatgtctcaaacatcatcacggagatccacccccgagacaggagtaccgtggagggccgt
gtgactttcgccaaagtggaggagaccatcgcggtgcgatgcctggctaagaatctcctt
ggagctgagaaccgagagctgaagctggtggctcccaccctgcgttctgaactcacggtg
gctgctgcagtcctggtgctgttggtgattgtgatcatctcacttattgtcctggttgtc
atttggaaacagaaaccgaggtatgaaattcgctggagggtcattgaatcaatcagcccg
gatggacatgaatatatttatgtggacccgatgcagctgccttatgactcaagatgggag
tttccaagagatggactagtgcttggtcgggtcttggggtctggagcgtttgggaaggtg
gttgaaggaacagcctatggattaagccggtcccaacctgtcatgaaagttgcagtgaag
atgctaaaacccacggccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgactcacctggggccacatttgaacattgtaaacttgctgggagcctgcaccaagtca
ggccccatttacatcatcacagagtattgcttctatggagatttggtcaactatttgcat
aagaatagggatagcttcctgagccaccacccagagaagccaaagaaagagctggatatc
tttggattgaaccctgctgatgaaagcacacggagctatgttattttatcttttgaaaac
aatggtgactacatggacatgaagcaggctgatactacacaatatgtccccatgctagaa
aggaaagaggtttctaaatattccgacatccagagatcactctatgatcgtccagcctca
tataagaagaaatctatgttagactcagaagtcaaaaacctcctttcagatgataactca
gaaggccttactttattggatttgttgagcttcacctatcaagttgcccgaggaatggag
tttttggcttcaaaaaattgtgtccaccgtgatctggctgctcgcaacgtcctcctggca
caaggaaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgattcg
aactatgtgtcgaaaggcagtacctttctgcccgtgaagtggatggctcctgagagcatc
tttgacaacctctacaccacactgagtgatgtctggtcttacggcattctgctctgggag
atcttttcccttggtggcaccccttaccccggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagcctgaccacgctaccagtgaagtctacgag
atcatggtgaaatgctggaacagtgagccggagaagagaccctccttttaccacctgagt
gagattgtggagaatctgctgcctggacaatataaaaagagttatgaaaaaattcacctg
gacttcctgaagagtgaccatcctgctgtggcacgcatgcgtgtggactcagacaatgca
tacattggtgtcacctacaaaaacgaggaagacaagctgaaggactgggagggtggtctg
gatgagcagagactgagcgctgacagtggctacatcattcctctgcctgacattgaccct
gtccctgaggaggaggacctgggcaagaggaacagacacagctcgcagacctctgaagag
agtgccattgagacgggttccagcagttccaccttcatcaagagagaggacgagaccatt
gaagacatcgacatgatggacgacatcggcatagactcttcagacctggtggaagacagc
ttcctgtaa

DBGET integrated database retrieval system