KEGG   Pan troglodytes (chimpanzee): 461472
Entry
461472            CDS       T01005                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04151  PI3K-Akt signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    461472 (IL2)
   04151 PI3K-Akt signaling pathway
    461472 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    461472 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    461472 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    461472 (IL2)
   04660 T cell receptor signaling pathway
    461472 (IL2)
   04658 Th1 and Th2 cell differentiation
    461472 (IL2)
   04659 Th17 cell differentiation
    461472 (IL2)
   04672 Intestinal immune network for IgA production
    461472 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    461472 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    461472 (IL2)
   05321 Inflammatory bowel disease
    461472 (IL2)
   05330 Allograft rejection
    461472 (IL2)
   05332 Graft-versus-host disease
    461472 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    461472 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    461472 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    461472 (IL2)
   05162 Measles
    461472 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    461472 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    461472 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    461472 (IL2)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   461472 (IL2)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Haparin
  Cytokines
   461472 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 461472
NCBI-ProteinID: XP_517425
Ensembl: ENSPTRG00000016418
VGNC: 617
UniProt: A0A6D2X586 H2QQ44
LinkDB
Position
4
AA seq 153 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system