KEGG   Pan troglodytes (chimpanzee): 461803
Entry
461803            CDS       T01005                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X3
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03460  Fanconi anemia pathway
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    461803 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    461803 (POLK)
   05202 Transcriptional misregulation in cancer
    461803 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    461803 (POLK)
   05212 Pancreatic cancer
    461803 (POLK)
   05225 Hepatocellular carcinoma
    461803 (POLK)
   05226 Gastric cancer
    461803 (POLK)
   05214 Glioma
    461803 (POLK)
   05216 Thyroid cancer
    461803 (POLK)
   05220 Chronic myeloid leukemia
    461803 (POLK)
   05217 Basal cell carcinoma
    461803 (POLK)
   05218 Melanoma
    461803 (POLK)
   05213 Endometrial cancer
    461803 (POLK)
   05224 Breast cancer
    461803 (POLK)
   05222 Small cell lung cancer
    461803 (POLK)
   05223 Non-small cell lung cancer
    461803 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    461803 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptr03400]
    461803 (POLK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     461803 (POLK)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    461803 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12 Olduvai
Other DBs
NCBI-GeneID: 461803
NCBI-ProteinID: XP_001149179
Ensembl: ENSPTRG00000016997
VGNC: 8631
UniProt: H2R452 A0A6D2X806
LinkDB
Position
5
AA seq 871 aa
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNK
LSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKRQQRSIIGFLQAGNQAL
SATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQ
VLKKKINENLEISENSDDCQIFTCPVCFRTQGCISLEALNKHVDECLDGPSISENFKMFS
CSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDCIALVDTIDNSSKAESIDALS
NKHSKEECSSLPSKYFNIEHCHQNSSSTVSLENEDVGSLSRQEYRQPYLCEVKTGQALVC
PVCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVT
RTKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggagatttggtgttcgtgcagccatgccaggatttattgctaagaggctg
tgcccacaacttataatagtgcccccaaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaagctctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcatgaacgatccatctctccactactttttgaagagagtccttctgatgtg
cagcccccaggagatcctttccaagtgaactttgaagaacaaaacaatcctcaaatactc
caaaactcagttgtttttggaacatcagcccaggaagtggtaaaggaaattcgtttcaga
attgagcagaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacatgtacagaactttaccaacagagg
gcattgctttctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacacacctgacgagggatggagagaggaaaagtatgagcgttgagagg
acattcagtgagataaataaagcggaagagcaatacagcctatgtcaagaactttgcagt
gagcttgctcaggatctacagaaagaaagacttaagggtagaactgttaccattaagttg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaggaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaaggcttatgggtgttcggatatctagttttcccaatgaagag
gacaggaaacgccaacaaaggagcattattggctttttacaggctggaaaccaagccctg
tcagccactgagtgtacattagagaaaactgacaaagataagtttgtgaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgaagccgtgaataaacaaagtttccagacatcacaaccattccaa
gttttaaagaagaagataaatgagaatttggaaatatcagagaattcagatgactgtcag
atatttacctgtcctgtttgctttaggactcaagggtgcatcagtctggaagccttgaat
aaacatgtagatgaatgtcttgatggaccttcaatcagtgaaaactttaaaatgttctcg
tgttcacatgtttctgctaccaaagttaacaagaaagaaaatgttcctgcttcttcactt
tgtgagaagcaagattatgaagcccatccaaaaattaaagaaatatcttcagtagattgt
atagctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaagt
aataagcatagcaaggaagaatgttctagtctcccaagcaagtattttaatattgaacac
tgtcatcagaattcttcttctactgtttcattggaaaacgaagatgttggatcattaagt
agacaagaataccgccagccttacttatgtgaagtgaaaacaggccaagctctagtttgt
cctgtttgtaacgtagaacaaaagacttcagatctaaccctgttcaatgtgcatgtggat
gtttgcttaaataaaagttttatccaagaattaagaaaggataaatttaacccagttaat
caacccaaagaaagctccagaagtactggtagctcaagtggagtacagaaggctgtaaca
agaacaaaaaggccaggattgatgacaaagtactcaacatcaaagaaaataaaaccaaac
aatcccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system