KEGG   Pan troglodytes (chimpanzee): 462033Help
Entry
462033            CDS       T01005                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00053  Ascorbate and aldarate metabolism
ptr00071  Fatty acid degradation
ptr00260  Glycine, serine and threonine metabolism
ptr00280  Valine, leucine and isoleucine degradation
ptr00310  Lysine degradation
ptr00330  Arginine and proline metabolism
ptr00340  Histidine metabolism
ptr00380  Tryptophan metabolism
ptr00410  beta-Alanine metabolism
ptr00561  Glycerolipid metabolism
ptr00620  Pyruvate metabolism
ptr01100  Metabolic pathways
Module
ptr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ptr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    462033 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    462033 (ALDH7A1)
   00620 Pyruvate metabolism
    462033 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    462033 (ALDH7A1)
   00561 Glycerolipid metabolism
    462033 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    462033 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    462033 (ALDH7A1)
   00310 Lysine degradation
    462033 (ALDH7A1)
   00330 Arginine and proline metabolism
    462033 (ALDH7A1)
   00340 Histidine metabolism
    462033 (ALDH7A1)
   00380 Tryptophan metabolism
    462033 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    462033 (ALDH7A1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     462033 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     462033 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     462033 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 462033
NCBI-ProteinID: XP_001157473
LinkDB All DBs
Position
5
AA seq 657 aa AA seqDB search
MCIYHDDQVITRILQFQNPCYSLLYFSANILLKIPSWNCGSRSLSPDGSSPLLPVALPLF
QAGFSRRLLRKTRGRRGGGGVVPSGRGRVCPMGSPGRGAGLYFSSSQGLVLIPSPGLSMW
RLPRALCVHAAKTSKLPGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWGGR
GEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALR
EKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQW
NPIGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDNK
LPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNA
IIAFEDADLSLVVPSALFAAVGTAGQRCTTVRRLFIHESIHDEVVNRLKKAYAQIRVGNP
WDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDAS
IAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVN
VNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatttaccacgacgaccaggtcattacacgcattttacagtttcagaacccctgc
tatagcctactgtacttcagcgccaatattttgctcaaaattcccagctggaactgtggc
tcccggagtctttcaccagatggcagcagcccactcctccctgtagcactcccattgttc
caggcaggattcagccgcaggctcctccggaagaccaggggccgacggggcggtggcggg
gtcgtgcccagtgggaggggtcgggtctgcccaatgggttctcccgggcggggggcgggg
ctctatttcagcagctctcagggccttgtgctcatcccgagtcccgggctcagtatgtgg
cgcctgccacgcgcgctgtgtgtgcatgctgcaaagaccagcaagctccctggaccttgg
agcaggcctgccgccttcatgtccactctcctcatcaatcagccccagtatgcgtggctg
aaagagctggggctccgcgaggaaaacgagggcgtgtataatggcagctggggaggccgg
ggagaggttattacgacctattgccctgctaacaacgagccaatagcaagagtccgacag
gccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcatggaaaatctgg
gcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgccttgcgg
gagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatcttagtggaa
ggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggtttatcaagg
atgattggaggacctatcttgccttctgaaagatctggccatgcactgattgagcagtgg
aatcccataggcctggttggaatcatcacggcattcaatttccctgtggcagtgtatggt
tggaacaacgccatcgccatgatctgtggaaatgtctgcctctggaaaggagctccaacc
acttccctcattagtgtggctgtcacaaagataatagccaaggttctggaggacaacaag
ctgcctggtgcaatttgttccttgacttgtggtggagcagatattggcacagcaatggcc
aaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaacaggtg
ggcctgatggtgcaggagaggtttgggagaagtctgttggaacttggaggaaacaatgcc
attattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttcgctgcc
gtgggaacagctggccagaggtgtaccactgtgaggcgactgtttatacatgaaagcatc
catgatgaggttgtaaacagacttaaaaaggcctatgcacagatccgagttgggaaccca
tgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatgtttctt
ggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaaggttatg
gatcgccctggaaattacgtagaaccgacaattgtgacaggtcttggccacgatgcgtcc
attgcacacacagagacttttgctccgattctctatgtctttaaattcaagaatgaagaa
gaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatctttaccaaa
gatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcattgtaaat
gtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaagcacact
ggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtctacttgt
actatcaactacagtaaagaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system