KEGG   Pan troglodytes (chimpanzee): 462158
Entry
462158            CDS       T01005                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04390  Hippo signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr05200  Pathways in cancer
ptr05218  Melanoma
ptr05224  Breast cancer
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    462158 (FGF1)
   04014 Ras signaling pathway
    462158 (FGF1)
   04015 Rap1 signaling pathway
    462158 (FGF1)
   04390 Hippo signaling pathway
    462158 (FGF1)
   04151 PI3K-Akt signaling pathway
    462158 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    462158 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    462158 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    462158 (FGF1)
   05218 Melanoma
    462158 (FGF1)
   05224 Breast cancer
    462158 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    462158 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    462158 (FGF1)
Cytokines and growth factors [BR:ptr04052]
 Growth factors
  Growth factors (RTK binding)
   462158 (FGF1)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   462158 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 462158
NCBI-ProteinID: XP_001153487
Ensembl: ENSPTRG00000017361
VGNC: 6875
UniProt: A0A663DA17 A0A2J8NIY5
LinkDB
Position
5
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaacggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttccgattaa

DBGET integrated database retrieval system