KEGG   Pan troglodytes (chimpanzee): 462944
Entry
462944            CDS       T01005                                 

Gene name
FYN
Definition
(RefSeq) tyrosine-protein kinase Fyn isoform X1
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04360  Axon guidance
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04520  Adherens junction
ptr04611  Platelet activation
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04725  Cholinergic synapse
ptr05020  Prion disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    462944 (FYN)
   04071 Sphingolipid signaling pathway
    462944 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    462944 (FYN)
   04520 Adherens junction
    462944 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    462944 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    462944 (FYN)
   04660 T cell receptor signaling pathway
    462944 (FYN)
   04664 Fc epsilon RI signaling pathway
    462944 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    462944 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    462944 (FYN)
   04380 Osteoclast differentiation
    462944 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    462944 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    462944 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    462944 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    462944 (FYN)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     462944 (FYN)
Protein kinases [BR:ptr01001]
 Non-receptor tyrosine kinases
  SRC family
   462944 (FYN)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    462944 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    462944 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 zf-RING_14
Other DBs
NCBI-GeneID: 462944
NCBI-ProteinID: XP_001159342
Ensembl: ENSPTRG00000018511
VGNC: 9963
UniProt: A0A2I3SKP4 A0A6D2Y4M7
LinkDB
Position
6
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggcgtgacctccatccccaactacaacaacttccatgcagccgggggccaagga
ctcaccgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactctttgtggccctttatgactatgaagcacggacagaagatgac
ctaagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactacattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctatgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaacaaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgacttcggattggcccgattgatcgaagacaatgagtac
acagcaagacaaggtgcaaagttccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtcgag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctg
gaagactactttaccgcgacagagccccagtaccaacctggtgaaaacctgtaa

DBGET integrated database retrieval system