KEGG   Pan troglodytes (chimpanzee): 463288
Entry
463288            CDS       T01005                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01523  Antifolate resistance
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04657  IL-17 signaling pathway
ptr04659  Th17 cell differentiation
ptr04668  TNF signaling pathway
ptr04672  Intestinal immune network for IgA production
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05010  Alzheimer disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05134  Legionellosis
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05143  African trypanosomiasis
ptr05144  Malaria
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
ptr05332  Graft-versus-host disease
ptr05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    463288 (IL6)
   04668 TNF signaling pathway
    463288 (IL6)
   04066 HIF-1 signaling pathway
    463288 (IL6)
   04068 FoxO signaling pathway
    463288 (IL6)
   04151 PI3K-Akt signaling pathway
    463288 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    463288 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    463288 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    463288 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    463288 (IL6)
   04620 Toll-like receptor signaling pathway
    463288 (IL6)
   04621 NOD-like receptor signaling pathway
    463288 (IL6)
   04623 Cytosolic DNA-sensing pathway
    463288 (IL6)
   04625 C-type lectin receptor signaling pathway
    463288 (IL6)
   04659 Th17 cell differentiation
    463288 (IL6)
   04657 IL-17 signaling pathway
    463288 (IL6)
   04672 Intestinal immune network for IgA production
    463288 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    463288 (IL6)
   05202 Transcriptional misregulation in cancer
    463288 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    463288 (IL6)
   05321 Inflammatory bowel disease
    463288 (IL6)
   05332 Graft-versus-host disease
    463288 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    463288 (IL6)
   05020 Prion disease
    463288 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    463288 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    463288 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    463288 (IL6)
   04931 Insulin resistance
    463288 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    463288 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    463288 (IL6)
   05135 Yersinia infection
    463288 (IL6)
   05133 Pertussis
    463288 (IL6)
   05134 Legionellosis
    463288 (IL6)
   05152 Tuberculosis
    463288 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    463288 (IL6)
   05161 Hepatitis B
    463288 (IL6)
   05171 Coronavirus disease - COVID-19
    463288 (IL6)
   05164 Influenza A
    463288 (IL6)
   05162 Measles
    463288 (IL6)
   05168 Herpes simplex virus 1 infection
    463288 (IL6)
   05163 Human cytomegalovirus infection
    463288 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    463288 (IL6)
   05169 Epstein-Barr virus infection
    463288 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    463288 (IL6)
   05144 Malaria
    463288 (IL6)
   05142 Chagas disease
    463288 (IL6)
   05143 African trypanosomiasis
    463288 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    463288 (IL6)
   01523 Antifolate resistance
    463288 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    463288 (IL6)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   463288 (IL6)
SSDB
Motif
Pfam: IL6
Other DBs
NCBI-GeneID: 463288
NCBI-ProteinID: XP_009451030
Ensembl: ENSPTRG00000018979
VGNC: 4400
LinkDB
Position
7
AA seq 252 aa
MNSVSTSKCRKSLALELPAAVEPCVREGCVAQGGLAGGQQQRQAPSCAVSSPLRSLPSGT
GAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISA
LRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYL
EYLQNRFESSEEQARAVQMSTKVLIQFLQKKVGVSSFPQLGVGEDRLKDSVLDNSGMQCH
FQKRRLQVNKRV
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagtaagtgcaggaaatccttagccctggaactgccagcggcg
gtcgagccctgtgtgagggaggggtgtgtggcccagggagggctggcgggcggccagcag
cagaggcaggctcccagctgtgctgtcagctcacccctgcgctcgctcccctccggcaca
ggcgccttcggtccagttgccttctccctggggctgctcctggtgttgcctgctgccttc
cctgccccagtacccccaggagaagattccaaagatgtagccgccccacacagacagcca
ctcacctcttcagaacgaattgacaaacaaattcggtacatcctcgacggcatctcagcc
ctgagaaaggagacatgtaacaagagtaacatgtgtgaaagcagcaaagaggcactggca
gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc
aatgaggagacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta
gagtacctccagaacagatttgagagtagtgaggaacaagccagagctgtgcagatgagt
acaaaagtcctgatccagttcctgcagaaaaaggtgggtgtgtcctcattccctcaactt
ggtgtgggggaagacaggctcaaagacagtgtcctggacaactcagggatgcaatgccac
ttccaaaagagaaggctacaagtaaacaaaagagtctga

DBGET integrated database retrieval system