KEGG   Pan troglodytes (chimpanzee): 463458Help
Entry
463458            CDS       T01005                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00512  Mucin type O-glycan biosynthesis
ptr01100  Metabolic pathways
Module
ptr_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    463458 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptr01003]
    463458 (GALNT17)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     463458 (GALNT17)
Glycosyltransferases [BR:ptr01003]
 O-Glycan biosynthesis
  Mucin-type
   463458 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ricin_B_lectin Glycos_transf_2 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 463458
NCBI-ProteinID: XP_016813051
Ensembl: ENSPTRG00000019262
LinkDB All DBs
Position
7
AA seq 582 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGA
EPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDP
SLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRV
AHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRA
LRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAILYPCHG
WGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQ
NGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtagctggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcttgaagcgcctgtcgctgctggaggacatcgtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggccttccg
gctactctttccccggctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaacgaggccctgtcggtgatcctgcggtccgtgcacagtgccgtcaatcacacaccc
acacacctgctgaaggaaatcattctggtggatgacaacagcgacgaagaggagctgaag
gtccccctggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggccactggggct
gagccagttctatcccgcatccaggaaaaccggaagcgtgtgatcctcccctccattgac
aacatcaaacaggacaactttgaggtgcagcggtacgagaactcggcccacgggtacagc
tgggagctgtggtgcatgtacatcagccccccaaaagactggtgggacgccggagaccct
tctctccccatcaggaccccagccatgataggctgctcgttcgtggtcaacaggaagttc
ttcggtgaaattggtcttctggatcctggcatggatgtatacggaggagaaaatattgaa
ctgggaatcaaggtatggctctgtgggggcagcatggaggtccttccttgctcacgggtg
gcccacattgagcggaagaagaagccatataatagcaacattggcttctacaccaagagg
aatgctcttcgtgttgctgaggtctggatggacgattacaagtctcatgtgtacatagcg
tggaacctgccgctggagaatccgggaattgacatcggtgatgtctccgaaagaagagca
ttaaggaaaagtttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaa
atgagaagatacaataataccgttgcttacggggagcttcgcaacaacaaggcaaaagac
gtctgcttggaccaggggccgctggagaaccacacagcaatattgtatccgtgccatggc
tggggaccacagcttgcccgctacaccaaggaaggcttcctgcacttgggtgccctgggg
accaccacactcctccctgacacccgctgcctggtggacaactccaagagtcggctgccc
cagctcctggactgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccag
aatggagccatcatgaacaagggcacgggacgctgcctggaggtggagaaccgcggcctg
gctggcatcgacctcatcctccgcagctgcacaggtcagaggtggaccattaagaactcc
atcaagtag

DBGET integrated database retrieval system