KEGG   Pan troglodytes (chimpanzee): 463781Help
Entry
463781            CDS       T01005                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04068  FoxO signaling pathway
ptr04150  mTOR signaling pathway
ptr04270  Vascular smooth muscle contraction
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr05034  Alcoholism
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    463781 (BRAF)
   04010 MAPK signaling pathway
    463781 (BRAF)
   04012 ErbB signaling pathway
    463781 (BRAF)
   04068 FoxO signaling pathway
    463781 (BRAF)
   04024 cAMP signaling pathway
    463781 (BRAF)
   04150 mTOR signaling pathway
    463781 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    463781 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    463781 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    463781 (BRAF)
   04062 Chemokine signaling pathway
    463781 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    463781 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    463781 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    463781 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    463781 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    463781 (BRAF)
   04720 Long-term potentiation
    463781 (BRAF)
   04730 Long-term depression
    463781 (BRAF)
   04722 Neurotrophin signaling pathway
    463781 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    463781 (BRAF)
   05205 Proteoglycans in cancer
    463781 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    463781 (BRAF)
   05212 Pancreatic cancer
    463781 (BRAF)
   05225 Hepatocellular carcinoma
    463781 (BRAF)
   05226 Gastric cancer
    463781 (BRAF)
   05214 Glioma
    463781 (BRAF)
   05216 Thyroid cancer
    463781 (BRAF)
   05221 Acute myeloid leukemia
    463781 (BRAF)
   05220 Chronic myeloid leukemia
    463781 (BRAF)
   05218 Melanoma
    463781 (BRAF)
   05211 Renal cell carcinoma
    463781 (BRAF)
   05219 Bladder cancer
    463781 (BRAF)
   05215 Prostate cancer
    463781 (BRAF)
   05213 Endometrial cancer
    463781 (BRAF)
   05224 Breast cancer
    463781 (BRAF)
   05223 Non-small cell lung cancer
    463781 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    463781 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    463781 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    463781 (BRAF)
   05160 Hepatitis C
    463781 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    463781 (BRAF)
   01522 Endocrine resistance
    463781 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    463781 (BRAF)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     463781 (BRAF)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   463781 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo Rtt106_N
Motif
Other DBs
NCBI-GeneID: 463781
NCBI-ProteinID: XP_009452635
Ensembl: ENSPTRG00000019769
VGNC: 14003
LinkDB All DBs
Position
7
AA seq 756 aa AA seqDB search
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQENLQPSSSHHHGS
ICSYFLSLVFVQFVNIKTQFCSSNLFLKIQNFQCIS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attccggaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggataccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatgtggcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatttcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacgttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaagttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaagaggcgtccttagcagagactgccctaacatctggatcatccccttccgcacccgcc
tcggactctattgggccccaaattctcaccagtccgtctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccga
tcctcatcagctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgctaccccc
cctgcctcattacctggctcactaactaacgtgaaagccttacagaaatctccaggacct
cagcgagaaaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaacacttggt
agacgggactcgagtgatgattgggagattcctgatgggcagattacagtgggacaaaga
attggatctggatcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacatgtgaatatcctactcttcatgggctattccacaaag
ccacaactggctattgttacccagtggtgtgagggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatacagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctgtctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactctttccccaagagaatttgcagccttcaagtagccaccatcatggcagc
atctgctcttatttcttaagtcttgtgttcgtacaatttgttaacatcaaaacacagttc
tgttcctcaaatctttttttaaagatacaaaatttccaatgcataagctga

DBGET integrated database retrieval system