KEGG   Pan troglodytes (chimpanzee): 463790Help
Entry
463790            CDS       T01005                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00052  Galactose metabolism
ptr00500  Starch and sucrose metabolism
ptr01100  Metabolic pathways
ptr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    463790 (MGAM2)
   00500 Starch and sucrose metabolism
    463790 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    463790 (MGAM2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     463790 (MGAM2)
    3.2.1.20  alpha-glucosidase
     463790 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 463790
NCBI-ProteinID: XP_016800999
UniProt: A0A2I3RPE2
LinkDB All DBs
Position
7
AA seq 2515 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGSADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNNNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASNNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDSLLLKSSRH
YLNIRYTLLPYLYTLFYHAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQGLILGQEF
SIRWNLPVSDLEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLPMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSAVIWDSQLPGFTFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFARDEPPAYKKNSYGVHPYHMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFHLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSDEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEHYNVHNLYG
WSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSIIGMMEFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMFSR
KVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAVLISPVL
ETSTFEISAYFPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNK
YLSDSNPLKIGYIRIWGVNTYVTQVSFTYDNRQFMETNFRSEPYNQILTIQLTNKTINLE
KLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTATVPI
TTTSFPSTTSVTTNTTVPDTTSPFPTSTTNASTNATVPITTTPFPTSTIGVTTNATVPDT
TAPFPTNSTTASTNATVPITTTCFATSTIGVTTNATVPDTTAPFPTNTTTASPNATIPIT
TTPFATSTIGVTTSTTVPDTTAYFPTSTTSASTNATPVPITTTLFATSTIGVTTGTTVPD
TTAPFPTSTTGASTSATVPITTTPSPTNTADANTSNTVPNTTMPSPTSSTTVSTLATIPI
SVTPSLTSTADATMSTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVAN
ITATSHTGTDDTVPNNTVPVTAIPSLANTGVDTTSNSFSIMTTSFSESTNAMNTAVIMAT
TSPTSTDVASTNNDASMTNFLLATMSSGNATSNNISITTTSFGNSVPFVTTPSPSTDATT
TSNNTNPGMTTYYQTSPTIPTHTLTSIPSSITSILSMFPTSNTFTTDKITNFTTPTNANT
IIFNTLDTKSTMVIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFATPHSATTTTLAL
SHTSLAPTNLSNLGTMDITDADNSSSVTGNTTHISVSNLTTASVTITATGLDSQTPHMVT
NSVATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPTYIANAINATQVP
NT seq 7548 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtg
accatagatatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccaatcggaaaggatagactgcacacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcgcctgtggcagatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccgtcaccatctctgtttggaaat
gatgttgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggagtgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccgccacaatatgacctggaagacttggcccatc
ttcacccgggacgctacccccaccgagggcatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagatgccagtggctcctcttttggagtatttctgatgaacaataat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacgattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatggacag
aaatatcttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggctttgctgttggggaggga
tatccaggaccgacagtctttcccgattataccaatccagtatgcactgagtggtggaca
gatcaggtcgctaaatttcatgatcacctggagtttgatggagtgtggattgaaatgaat
gaagtatctagcttactccaagcttctaataaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatgggggccttcattatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccatcttcatgaataataggagcttcatcttatcc
cgttctacgtttgctggatctggcaaatttgctgctcattggctgggggacaatgcggcc
acgtgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcccgctgcctttggtgttgattccctgctgctgaaatcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccatgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacacctgttttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatcccatggaggaaacagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
gccagccggaggaactccctgggactcatcatcgctttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtgactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
atggacactgacaacctcatgtttacagatatcacaatcttgggaatggacaaacagcca
gctaattttatcgtcctactgaataatgttgccacctccagtccaagcgttgtctacaat
gcttccacaaaggtggtaaccatcactgatctccaaggactgatactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacctggagaagttcaactgctatcctgatgat
ccaacagcctctgaggagagttgtaggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgacattcag
tacctgaacaccagcatcactgcagacctttccctcccgatggcccctgagtcagctgct
gctgccgcctctgattctctctctgcaaagatcagcttcctccacctgaacgtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtatgaggtt
ccagtaccactcaacacccctccccaaccagttggtgaccctgaaaaccgtctgtatgat
gtcaggattcagaacaatccttttggaatccagattcaacgcaaaaactccagcgctgtg
atctgggattctcaactccctggcttcaccttcaatgacatgtttctctccatttctacg
cgtctgccatctcagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgaactggaacacatggggaatgtttgctcgtgatgagccacctgcgtacaagaag
aattcctatggtgtccacccttaccacatggcactggaggaggatggtagtgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgctctgaca
taccgcaccactggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgatcggtcggccagcaatgattccatactgggccttg
ggattccatctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accaatgacattgtctggggaaaggtttggccagatctgcctaatgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctatgcaaaccct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagtgatgaaatgctaaataacccaccctat
atgccatatttggaatctagggacaagggcctgagcagcaagactctgtgcatggagagt
cagcagatcctgccggacagctcccccgtggagcactacaacgtgcacaacctgtacggg
tggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtc
atcatcacccgctccacatttccctcttctggacgctggggaggacaccggttgggaaac
aacacagctgcatgggaccagctggggaaatctatcattggcatgatggagttcagtctc
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
atcgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttttccaga
aaagtcctagagaccagatacaccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcacagttgtccggccccttctccatgagtttacggatgacagaaca
acatgggatatagaccgtcagttcatgttgggccctgctgtcttaatcagccctgtgttg
gaaactagcacatttgagatctctgcttattttccgagagcccgttggtatgactatagc
acgggaactagcagcacatcaacaggtcagaggaaaatcctgaaggctccccttgaccac
atcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgcaatgaacact
cactccagtcgacaaaattttatgggattgattgttgctttggatgacaatgggacagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggctaactttatagcagctcagaacatcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaaattgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagtttcacctatgacaaccggcaatttatggagacaaatttcagg
agtgaaccttataatcagatactaactattcaattgactaacaagactatcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactaagaca
agtaccatcccaatgagttctcatccttctccatctactaccaatgccaccagttctgag
acaatcaccagttctgccagtgcaaatactaccactggcactactgctactgttcctatc
acaaccacatctttcccaagtactactagtgttacaactaatactactgttcctgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacctttcccaacaagtactattggtgttacaactaatgctactgttcccgataca
actgctcctttcccaacaaatagtactactgctagcactaatgctactgttcctatcaca
accacatgttttgcaacaagtactattggtgttacaactaatgctactgttcccgataca
actgcccctttcccaacaaatactactactgctagccctaatgctactattcctatcaca
accacaccttttgcaacaagtactattggtgttacaactagtactactgttcctgataca
actgcttatttccctacaagtactactagtgctagcactaatgctacccctgttcctatc
acaaccacactttttgcaacaagtactattggtgttacaactggtactactgttcctgat
acaactgctcctttccctacaagtactactggtgctagcactagtgctactgttcctatt
acaaccacaccttcccctacaaatactgctgatgctaacactagtaatactgttcctaat
accactatgccttctcctacaagtagtactactgtgagtactcttgctaccattcccatt
tcagtgactccttctctgacaagtactgctgatgccaccatgagtactactgtacttatt
gccactacttcttctctaacaggtactactgatgttagcactagtactactattaataat
ataagtactcctgttcaaacaaatactactaatgctagcactagtactaatgttgctaat
ataactgctacctctcatacaggtactgatgatactgttcctaataatactgttccagtt
acagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttccatt
atgaccacttctttctctgaaagtactaatgctatgaacactgctgttattatggcaact
acttctcctacaagtactgatgttgctagcacaaataatgatgcttctatgacaaatttt
cttttagctacaatgtcttctggtaatgcaactagtaataatatttccataacaactact
tcttttggtaatagtgttccttttgtgactactccttctccaagtactgatgctactact
acaagtaataatactaatcctggcatgactacttattaccagacttctcctaccattcct
acccatactcttacttctattcctagctctattacttctattttgagcatgtttccaaca
agtaatacattcactactgataaaattactaattttactacccctacaaatgcaaacacc
attattttcaacactcttgatacaaaaagtaccatggtaatagatgctacggtcactact
accagcaccaaagataataccatgagtccagatacaacagttacttccatagacaaattc
accacacacatcacacagttcgctactccccattctgctactactacaacactggcctta
agccacacctcattagctcctacaaatctttctaatctaggcaccatggatattactgat
gcagataactccagcagtgttacaggtaacacgacacacatttctgtttcaaatctcaca
acagcctcagtcacaataacagccactggtctagattcacaaactccccatatggtaaca
aattctgtggctacttatttacctattactgcaactagtgctaccacagatactacaaat
attacaaaatatgctttaaatactaccactcctgatagtacagtacatacctctgctact
gcacctacttatattgcaaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system