KEGG   Pan troglodytes (chimpanzee): 464393
Entry
464393            CDS       T01005                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04110  Cell cycle
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04310  Wnt signaling pathway
ptr04350  TGF-beta signaling pathway
ptr04390  Hippo signaling pathway
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04630  JAK-STAT signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr05132  Salmonella infection
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05213  Endometrial cancer
ptr05216  Thyroid cancer
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    464393 (MYC)
   04012 ErbB signaling pathway
    464393 (MYC)
   04310 Wnt signaling pathway
    464393 (MYC)
   04350 TGF-beta signaling pathway
    464393 (MYC)
   04390 Hippo signaling pathway
    464393 (MYC)
   04630 JAK-STAT signaling pathway
    464393 (MYC)
   04151 PI3K-Akt signaling pathway
    464393 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    464393 (MYC)
   04218 Cellular senescence
    464393 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    464393 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    464393 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    464393 (MYC)
   05202 Transcriptional misregulation in cancer
    464393 (MYC)
   05206 MicroRNAs in cancer
    464393 (MYC)
   05205 Proteoglycans in cancer
    464393 (MYC)
   05230 Central carbon metabolism in cancer
    464393 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    464393 (MYC)
   05225 Hepatocellular carcinoma
    464393 (MYC)
   05226 Gastric cancer
    464393 (MYC)
   05216 Thyroid cancer
    464393 (MYC)
   05221 Acute myeloid leukemia
    464393 (MYC)
   05220 Chronic myeloid leukemia
    464393 (MYC)
   05219 Bladder cancer
    464393 (MYC)
   05213 Endometrial cancer
    464393 (MYC)
   05224 Breast cancer
    464393 (MYC)
   05222 Small cell lung cancer
    464393 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    464393 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    464393 (MYC)
   05161 Hepatitis B
    464393 (MYC)
   05160 Hepatitis C
    464393 (MYC)
   05163 Human cytomegalovirus infection
    464393 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    464393 (MYC)
   05169 Epstein-Barr virus infection
    464393 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    464393 (MYC)
   03019 Messenger RNA biogenesis [BR:ptr03019]
    464393 (MYC)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    464393 (MYC)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     464393 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 464393
NCBI-ProteinID: NP_001136266
Ensembl: ENSPTRG00000020581
LinkDB
Position
8
AA seq 454 aa
MDFFRIVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCPSQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt   +upstreamnt  +downstreamnt
ctggatttttttcggatagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacgcccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcccctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgacaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system