KEGG   Pan troglodytes (chimpanzee): 465021
Entry
465021            CDS       T01005                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    465021 (CDKN2A)
   04115 p53 signaling pathway
    465021 (CDKN2A)
   04218 Cellular senescence
    465021 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    465021 (CDKN2A)
   05206 MicroRNAs in cancer
    465021 (CDKN2A)
   05203 Viral carcinogenesis
    465021 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    465021 (CDKN2A)
   05225 Hepatocellular carcinoma
    465021 (CDKN2A)
   05214 Glioma
    465021 (CDKN2A)
   05220 Chronic myeloid leukemia
    465021 (CDKN2A)
   05218 Melanoma
    465021 (CDKN2A)
   05219 Bladder cancer
    465021 (CDKN2A)
   05223 Non-small cell lung cancer
    465021 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    465021 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    465021 (CDKN2A)
   05163 Human cytomegalovirus infection
    465021 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    465021 (CDKN2A)
   01522 Endocrine resistance
    465021 (CDKN2A)
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank
Other DBs
NCBI-GeneID: 465021
NCBI-ProteinID: NP_001139762
Ensembl: ENSPTRG00000020827
UniProt: A0A6D2XAZ8 H2QX30
LinkDB
Position
9
AA seq 156 aa
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPLDIPD
NT seq 471 nt   +upstreamnt  +downstreamnt
atggagccggcggcggggagcagtatggagccttcggctgactggctggccacggccgcg
gcccggggtcgggtagaggaggtgcgggcgctgctcgaggcgggggcgctgcccaacgca
ccgaatagttacggtcggaggccgatccaggtcatgatgatgggcagcgcccgcgtggcg
gagctgctgctgctccacggcgcggagcccaactgcgccgaccccgccactctcacccga
cccgtgcacgacgctgcccgggagggcttcctggacacgctggtggtgctgcaccgggcc
ggggcgcggctggacgtgcgcgatgcctggggccgtctgcccgtggacctggctgaggag
ctgggccatcgcgatgtcgcacggtacctgcgcgcggctgcggggggcaccagaggcagt
aaccatgcccgcatagatgccgcggaaggtcccttagacatccccgattga

DBGET integrated database retrieval system