KEGG   Pan troglodytes (chimpanzee): 466665
Entry
466665            CDS       T01005                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04137  Mitophagy - animal
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04218  Cellular senescence
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04917  Prolactin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05030  Cocaine addiction
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05134  Legionellosis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05321  Inflammatory bowel disease
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    466665 (RELA)
   04014 Ras signaling pathway
    466665 (RELA)
   04064 NF-kappa B signaling pathway
    466665 (RELA)
   04668 TNF signaling pathway
    466665 (RELA)
   04066 HIF-1 signaling pathway
    466665 (RELA)
   04071 Sphingolipid signaling pathway
    466665 (RELA)
   04024 cAMP signaling pathway
    466665 (RELA)
   04151 PI3K-Akt signaling pathway
    466665 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    466665 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    466665 (RELA)
   04218 Cellular senescence
    466665 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    466665 (RELA)
   04621 NOD-like receptor signaling pathway
    466665 (RELA)
   04622 RIG-I-like receptor signaling pathway
    466665 (RELA)
   04623 Cytosolic DNA-sensing pathway
    466665 (RELA)
   04625 C-type lectin receptor signaling pathway
    466665 (RELA)
   04660 T cell receptor signaling pathway
    466665 (RELA)
   04658 Th1 and Th2 cell differentiation
    466665 (RELA)
   04659 Th17 cell differentiation
    466665 (RELA)
   04657 IL-17 signaling pathway
    466665 (RELA)
   04662 B cell receptor signaling pathway
    466665 (RELA)
   04062 Chemokine signaling pathway
    466665 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    466665 (RELA)
   04917 Prolactin signaling pathway
    466665 (RELA)
   04926 Relaxin signaling pathway
    466665 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    466665 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    466665 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    466665 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    466665 (RELA)
   05202 Transcriptional misregulation in cancer
    466665 (RELA)
   05203 Viral carcinogenesis
    466665 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    466665 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    466665 (RELA)
   05221 Acute myeloid leukemia
    466665 (RELA)
   05220 Chronic myeloid leukemia
    466665 (RELA)
   05215 Prostate cancer
    466665 (RELA)
   05222 Small cell lung cancer
    466665 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    466665 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    466665 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    466665 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    466665 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    466665 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    466665 (RELA)
   04931 Insulin resistance
    466665 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    466665 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    466665 (RELA)
   05135 Yersinia infection
    466665 (RELA)
   05133 Pertussis
    466665 (RELA)
   05134 Legionellosis
    466665 (RELA)
   05152 Tuberculosis
    466665 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    466665 (RELA)
   05170 Human immunodeficiency virus 1 infection
    466665 (RELA)
   05162 Measles
    466665 (RELA)
   05164 Influenza A
    466665 (RELA)
   05161 Hepatitis B
    466665 (RELA)
   05160 Hepatitis C
    466665 (RELA)
   05168 Herpes simplex virus 1 infection
    466665 (RELA)
   05163 Human cytomegalovirus infection
    466665 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    466665 (RELA)
   05169 Epstein-Barr virus infection
    466665 (RELA)
   05165 Human papillomavirus infection
    466665 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    466665 (RELA)
   05145 Toxoplasmosis
    466665 (RELA)
   05140 Leishmaniasis
    466665 (RELA)
   05142 Chagas disease
    466665 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    466665 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    466665 (RELA)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    466665 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 466665
NCBI-ProteinID: NP_001233559
Ensembl: ENSPTRG00000003889
VGNC: 10283
UniProt: A0A6D2WC88 G2HHW9
LinkDB
Position
11
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVREPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggaaccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgacgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttccgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system