KEGG   Pan troglodytes (chimpanzee): 466947
Entry
466947            CDS       T01005                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04012  ErbB signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04151  PI3K-Akt signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing syndrome
ptr05162  Measles
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    466947 (CDKN1B)
   04066 HIF-1 signaling pathway
    466947 (CDKN1B)
   04068 FoxO signaling pathway
    466947 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    466947 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    466947 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    466947 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    466947 (CDKN1B)
   05206 MicroRNAs in cancer
    466947 (CDKN1B)
   05203 Viral carcinogenesis
    466947 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    466947 (CDKN1B)
   05220 Chronic myeloid leukemia
    466947 (CDKN1B)
   05215 Prostate cancer
    466947 (CDKN1B)
   05222 Small cell lung cancer
    466947 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    466947 (CDKN1B)
   04934 Cushing syndrome
    466947 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    466947 (CDKN1B)
   05169 Epstein-Barr virus infection
    466947 (CDKN1B)
   05165 Human papillomavirus infection
    466947 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    466947 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 466947
NCBI-ProteinID: XP_522347
Ensembl: ENSPTRG00000004707
VGNC: 8367
UniProt: H2Q5H2 A0A6D2X419
LinkDB
Position
12
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system