KEGG   Pan troglodytes (chimpanzee): 467221
Entry
467221            CDS       T01005                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D isoform X1
  KO
K05492  interleukin 17D
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04657  IL-17 signaling pathway
ptr04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    467221 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    467221 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    467221 (IL17D)
   04659 Th17 cell differentiation
    467221 (IL17D)
   04657 IL-17 signaling pathway
    467221 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    467221 (IL17D)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   467221 (IL17D)
SSDB
Other DBs
NCBI-GeneID: 467221
NCBI-ProteinID: XP_016780512
LinkDB
Position
13
AA seq 210 aa
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYSLAPSGSSSGLTQPPQASALRGLR
MHPVSTISLLPGKSVYSALLCLYLFSLHVPPETIILFNHHLSVDNLKLCLQPRAPSAAPA
HLPPHSLRDLSKIPSEGHSFSLYFLVVTVP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgctggtagccggcttcctgctggcgctgccgccgagctgggccgcgggcgccccgagg
gcgggcaggcgcccggcgcggccgcggggctgcgcggaccggccagaggagctactggag
cagctgtacgggcgcctggcggccggcgtgctcagcgccttccaccacacgctgcagctg
gggccgcgtgagcaggcgcgcaacgcgagctgcccggcagggggcaggcccgccgaccgc
cgcttccggccgcccaccaacctgcgcagcgtgtcgccctgggcctacagcctggctcca
tcaggttcaagttcaggtttgacccagccccctcaagcctctgcccttcgtggactgagg
atgcacccagtctccaccatcagccttctccccgggaagtcggtgtactctgctctcctc
tgcctctatttgttctccctccatgtgcccccggagactatcatcttatttaaccaccat
ctatcggtggacaacttaaaactctgccttcagccaagagctccctctgcggctccagcc
catcttcccccccatagtctgagggatctttctaaaattccatctgagggacactctttc
tcgttgtacttcctagtggtgactgtcccttga

DBGET integrated database retrieval system