KEGG   Pan troglodytes (chimpanzee): 467404
Entry
467404            CDS       T01005                                 

Gene name
IL25
Definition
(RefSeq) interleukin-25
  KO
K05493  interleukin 17E
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    467404 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    467404 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    467404 (IL25)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   467404 (IL25)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 467404
NCBI-ProteinID: XP_009425780
Ensembl: ENSPTRG00000006171
VGNC: 3404
UniProt: H2Q808 A0A6D2VWH2
LinkDB
Position
14
AA seq 177 aa
MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVP
PLEPARLDRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQT
GSHMDPRGNSELLYHNQTVFYRRPCHGKKGTHKGYCLERRLYRVSLACVCVRPRVMG
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagggagcgacccagattaggtgaggacagttctctcattagccttttcctacaggtg
gttgcattcttggcaatggtcatgggaacccacacctacagccactggcccagctgctgc
cccagcaaagggcaggacacctctgaggagctgctgaggtggagcactgtgcctgtgcct
cccctagagcctgctaggctcgaccgccacccagagtcctgtagggccagtgaagatgga
cccctcaacagcagggccatctccccctggagatatgagttggacagagacttgaaccgg
ctcccccaggacctgtaccacgcccgttgcctgtgcccgcactgcgtcagcctacagaca
ggctcccacatggacccccggggcaactcggagctgctctaccacaaccagactgtcttc
taccggcggccatgccatggcaagaagggcacccacaagggctactgcctggagcgcagg
ctgtaccgtgtttccttagcttgtgtgtgtgtgcggccccgtgtgatgggctag

DBGET integrated database retrieval system