KEGG   Pan troglodytes (chimpanzee): 467426
Entry
467426            CDS       T01005                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04210  Apoptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04926  Relaxin signaling pathway
ptr04931  Insulin resistance
ptr05132  Salmonella infection
ptr05134  Legionellosis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05215  Prostate cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    467426 (NFKBIA)
   04668 TNF signaling pathway
    467426 (NFKBIA)
   04024 cAMP signaling pathway
    467426 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    467426 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    467426 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    467426 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    467426 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    467426 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    467426 (NFKBIA)
   04660 T cell receptor signaling pathway
    467426 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    467426 (NFKBIA)
   04659 Th17 cell differentiation
    467426 (NFKBIA)
   04657 IL-17 signaling pathway
    467426 (NFKBIA)
   04662 B cell receptor signaling pathway
    467426 (NFKBIA)
   04062 Chemokine signaling pathway
    467426 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    467426 (NFKBIA)
   04926 Relaxin signaling pathway
    467426 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    467426 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    467426 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    467426 (NFKBIA)
   05203 Viral carcinogenesis
    467426 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    467426 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    467426 (NFKBIA)
   05215 Prostate cancer
    467426 (NFKBIA)
   05222 Small cell lung cancer
    467426 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    467426 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    467426 (NFKBIA)
   05135 Yersinia infection
    467426 (NFKBIA)
   05134 Legionellosis
    467426 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    467426 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    467426 (NFKBIA)
   05161 Hepatitis B
    467426 (NFKBIA)
   05160 Hepatitis C
    467426 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    467426 (NFKBIA)
   05164 Influenza A
    467426 (NFKBIA)
   05162 Measles
    467426 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    467426 (NFKBIA)
   05163 Human cytomegalovirus infection
    467426 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    467426 (NFKBIA)
   05169 Epstein-Barr virus infection
    467426 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    467426 (NFKBIA)
   05140 Leishmaniasis
    467426 (NFKBIA)
   05142 Chagas disease
    467426 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    467426 (NFKBIA)
   04131 Membrane trafficking [BR:ptr04131]
    467426 (NFKBIA)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    467426 (NFKBIA)
Membrane trafficking [BR:ptr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    467426 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 467426
NCBI-ProteinID: XP_522823
Ensembl: ENSPTRG00000006265
VGNC: 8204
UniProt: H2Q867 A0A6D2XF86
LinkDB
Position
14
AA seq 317 aa
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg
aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaagacgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg
ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc
cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacagag
gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system