KEGG   Pan troglodytes (chimpanzee): 467871Help
Entry
467871            CDS       T01005                                 

Gene name
CASKIN1
Definition
(RefSeq) caskin-1 isoform X1
  KO
K21952  CASK-interacting protein
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    467871 (CASKIN1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    467871 (CASKIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Caskin-Pro-rich Ank_4 SAM_1 Caskin-tail Ank SAM_2 Ank_3 Caskin1-CID SH3_2 SH3_1 SH3_9 NCD1
Motif
Other DBs
NCBI-GeneID: 467871
NCBI-ProteinID: XP_016784112
Ensembl: ENSPTRG00000007645
VGNC: 5697
UniProt: H2QAC6
LinkDB All DBs
Position
16
AA seq 1430 aa AA seqDB search
MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNG
NTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLH
LAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPR
PGDATDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLL
LDSGINAHVRNTYSQTALDIVHQFTTSQASREIKQLLREASAALQVRATKDYCNNYDLTS
LNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAGSRAGTEPSLP
QGSSSSGPSAPPEEIWVLRKPFAGGDRSGSISGMAGGRGSGGHALHAGSEGVKLLATVLS
QKSVSESSPGDSTAKPPEGSAGVARSQPPVAHAGQVYGEQPPKKLEPASEGKSSEAVSQW
LTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPE
HKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVR
KLAELQKAEYAKYEGGPLRRKAPQSLEVMTIESPPPPEPTPADCQSPKMTTFQDSELSDE
LQAAMTGPAEVGPTAEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSP
MSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTP
TKTRPGSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPV
EGEVGPAALGPAPLPVPTAVPTLCLPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLV
PAAAGPYATVQRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASA
NLADEPVPDAEPEDGLLGVRAQCRRASDLASSVDTGSAGSVKSIAAMLELSSIGGGGRAA
RRPPEGHPTPRPASPEPGRVATVLASVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRG
PGESADPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEASATLKRRIRAKQNQQENVKF
ILTESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEP
PPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEV
KRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPS
LGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLA
AALQAVEEKIRQEDAQGPRDSAAEKSTGSILDDIGSMFDDLADQLDAMLE
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggagctggtgcaggcggtgaaggcggaggacgtagggaccgcgcag
aggctgctgcagaggccgcggcccgggaaggccaagctcctgggttccaccaagaagatc
aatgtcaacttccaggacccggatggcttctcggctctgcaccacgcggccctgaacggc
aacacggaattgatcagcctgctgctggaggcccaggccgctgtggacatcaaggacaac
aaaggcatgcggccgctgcactatgcggcctggcagggccggaaggagcccatgaagctg
gtgctgaaggcgggctcggccgtgaacatcccgtctgatgagggccacatccccctgcac
ctggcggcccagcatggtcactatgatgtgtctgagatgctgctacagcaccagtctaac
ccgtgcatggtggacaactcggggaagacgcccctggacctggcctgcgagttcggccgc
gttggggtggtccagctgctcctcagcagcaatatgtgtgcggcgctgctggagccccgg
ccgggagacgccaccgaccccaacggcaccagccctttgcacctcgcagccaaaaacggc
cacatcgacatcatcaggctcctcctccaagccggcatcgacattaaccgccagaccaag
tccggcacggccctgcacgaggctgcgctctgcggaaagacggaggtggtacggctgctg
ctggatagcgggatcaatgcccatgtgaggaacacctacagccagacagccctggacatc
gtgcaccagttcaccacgtcccaggccagcagggagatcaagcagctgttgcgagaggcc
tcagcggccctgcaggtccgggcgaccaaggattattgcaacaattacgacctgaccagc
ctcaacgtgaaggcaggggacatcatcacagtcctcgagcagcatccggatggccggtgg
aagggctgcatccatgacaaccggacgggcaatgaccgggtgggctacttcccgtcctcc
ctgggcgaggccattgtcaagcgagcaggttcccgagcaggcactgaaccaagcctgccc
cagggaagcagctcatcgggaccctctgcacccccagaggagatctgggtgctgaggaag
ccttttgcaggtggggaccgaagcggcagcattagcggcatggctggcggccggggcagc
gggggtcacgccctacatgcgggctctgagggcgtcaagctcctggcaacggtgctttcc
cagaagtccgtctctgagtccagcccgggggacagcaccgccaagcctccggaaggctct
gcaggtgtggcccggtcccagcctccagtggcccacgccgggcaggtctatggggagcag
ccacccaagaagctggagccagcatcggagggcaagagctccgaggccgtgagccagtgg
ctcaccgcgttccagctgcagctctacgcccccaacttcatcagcgccggctacgacctg
cccaccatcagccgcatgactcctgaggacctcacggccattggtgtcaccaagccgggc
caccggaagaagatcgcggcagagatcagcggcctaagcatccccgactggctgcctgag
cacaaacccgctaacctggccgtgtggctgtccatgattggcctggcccagtactacaag
gtgttggtggacaatggctacgagaacattgatttcatcaccgacatcacctgggaggac
ctgcaggagatcggcatcaccaagctggggcaccagaagaagctgatgctcgctgtgagg
aagctggcagagctgcagaaggctgaatacgccaagtatgaggggggccccctgcgccgg
aaggcgccccaatctcttgaagtgatgaccatcgagtcgccgcccccacctgagcccaca
ccggccgactgccagtcccctaaaatgaccaccttccaggacagcgagctcagtgacgag
ctgcaggctgccatgactggcccggctgaggtggggcccaccgctgagaagccctccagc
cacctgccacccaccccgagggccaccacgcggcaggactccagcctgggtggtcgggca
cggcacatgagcagctcgcaggagctgctgggagatgggccccctgggcccagcagcccc
atgtctcgaagccaggagtacctcctggatgagggccccgcccccggcaccccgcccagg
gaggcccggcccggccgccacggccacagcatcaagagggccagcgtgccccccgtgcct
ggcaagccacggcaggtcctcccaccaggcaccagccacttcacgcccccccagacgccc
accaaaacccgaccaggctctccccaggcccttgggggacctcatggtccagccccagct
acggccaaggtgaagcccaccccgcagctgctgccaccgacagagcgccccatgtcaccc
cgctccctgcctcagtcaccgacgcaccgcggctttgcctacgtgctgccccagcccgtg
gagggcgaggtggggccggctgccctggggcctgcgcccctacccgtgccgacggctgtg
cccacactgtgcctgccccccgaggccgacgcggagccggggcggcccaagaagcgggcc
cacagcctgaatcgctatgcggcgtccgacagcgagccggagcgggacgagctgctggtg
cctgcggctgccggcccctatgccacggtccagcggcgcgtgggccgcagccactcagtg
agggcgcccgcaggtgccgacaagaacgtcaaccgcagccagtcctttgccgtgcggccc
cgaaagaaggggcccccgccgcccccacccaagcgctccagctcggccctggctagtgcc
aacctggcagatgagccggtgccggacgccgagcctgaggatggcctgctgggggtccgg
gcacagtgccggcgggccagtgacctggccagcagcgtggacacaggcagtgccggcagt
gtgaagagcatcgcggccatgctggagctgtcctccattgggggtgggggccgggctgcc
cgcaggcctcctgagggccaccccactccccgccctgccagcccagagccgggccgggtg
gccaccgtgctggcctcagtgaaacacaaagaggccatcgggcctggcggggaggtggtg
aaccggcgccgcacgctcagcgggccagtcaccggacttctggccactgcccgccggggg
cctggggagtcggcagacccaggcccctttgtggaggatggcactggccggcagcggcct
cggggtccctccaagggcgaggcgggtgtcgaaggcccacccttggccaaggtggaagcc
agcgccacactcaagaggcgcatccgggccaagcagaaccagcaggagaacgtcaagttc
atcctgaccgagtccgacacggtcaagcgccggcccaaggccaaggagcgggaggccggg
cctgagccaccaccgccactgtccgtgtaccataatggcactggcaccgtgcgccgccga
ccggcctcggagcaggctgggcctccggagctgcctccaccgcccccgcctgccgaaccc
ccgcccaccgacctggcgcacctacccccattgcccccgcccgagggcgaagcccggaag
ccggccaagccgcctgtctctcccaagcccgtcctgacgcagcctgtgcccaagctccag
ggctcgcccacacccacctccaagaaggtgccgctgccaggccctggcagcccagaggtg
aagcgcgcccacggcacgccgccgcccgtgtctcccaagccgccgccgccgcccacagcg
cccaagcccgtcaaggcggtcgcggggctgccttcgggcagcgccggcccttcacccgca
ccctcgcccgcgcgacagccgcccgccgccctcgccaagccgcccggtacgccgccctcg
ctgggcgccagccccgccaagcccccgtcccccggcgcgcccgcgctgcacgtgcccgcc
aagcccccgcgagccgccgccgccgccgccgccgccgccgcgccccccgccccgcccgaa
ggcgcctcgccaggggacagcgcccggcagaaactggaggagacaagcgcgtgcctggcc
gcggcgctgcaggcggtggaggagaagatccggcaggaggacgcgcagggcccgcgcgac
tcggcggcggaaaagagcactggcagcatcctggacgacatcggcagcatgttcgacgac
ctggccgaccagctggatgccatgctggagtga

DBGET integrated database retrieval system