KEGG   Pan troglodytes (chimpanzee): 468067
Entry
468067            CDS       T01005                                 

Gene name
IL17C
Definition
(RefSeq) interleukin-17C
  KO
K05491  interleukin 17C
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    468067 (IL17C)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    468067 (IL17C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    468067 (IL17C)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   468067 (IL17C)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 468067
NCBI-ProteinID: XP_016784345
Ensembl: ENSPTRG00000008457
VGNC: 5807
LinkDB
Position
16
AA seq 205 aa
MTPPTCLFHQLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGHAPPHLL
ARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYR
VDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPT
PGAFAFHTEFIHVPVGCTCVLPRSV
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacgccacccacctgcctgtttcaccagctcctccctggcctcctgtttctgacctgg
ctgcacacatgcctggcccaccatgacccctccctcagggggcacccccacagtcacggt
accccacactgctactcggctgaggaactgcccctcggccacgcccccccacacctgctg
gctcgaggtgccaagtgggggcaggctttgcctgtagccctggtgtccagcctggaggca
gcaagccatagggggaggcacgagaggccctcagctacgacccagtgcccggtgctgcgg
ccagaggaggtgttggaggcagacacccaccagcgctccatctcaccctggagataccgt
gtggacacggatgaggaccgctatccacagaagctggccttcgccgagtgcctgtgcaga
ggctgtatcgatgcgcggacgggccgcgagacagctgcgctcaactccgtgcggctgctc
cagagcctgctggtgctgcgccgccggccctgctcccgcgacggctcggggctccccaca
cctggggcctttgccttccacaccgagttcatccacgtccccgtcggctgcacctgcgtg
ctgccccgttcagtgtga

DBGET integrated database retrieval system