KEGG   Pan troglodytes (chimpanzee): 468208
Entry
468208            CDS       T01005                                 

Gene name
CCL11
Definition
(RefSeq) eotaxin
  KO
K16597  C-C motif chemokine 11
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04062  Chemokine signaling pathway
ptr04657  IL-17 signaling pathway
ptr05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    468208 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    468208 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    468208 (CCL11)
   04062 Chemokine signaling pathway
    468208 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    468208 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    468208 (CCL11)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Chemokines
   468208 (CCL11)
SSDB
Motif
Pfam: IL8 Tetraspanin
Other DBs
NCBI-GeneID: 468208
NCBI-ProteinID: XP_523599
Ensembl: ENSPTRG00000009001
VGNC: 9168
UniProt: A0A6D2XBM0 A0A2I3TV26
LinkDB
Position
17
AA seq 97 aa
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcacttctgtggctgctgctcatagcagctgccttcagcccccag
gggctcgctgggccagcttctgtcccaaccacctgctgctttaacctggccaataggaag
ataccccttcagcgactggagagctacaggagaatcaccagtggcaaatgtccccagaaa
gctgtgatcttcaagaccaaactggccaaggatatctgtgccgaccccaagaagaagtgg
gtgcaggattccatgaagtatctggaccaaaaatctccaactccaaagccataa

DBGET integrated database retrieval system