KEGG   Pan troglodytes (chimpanzee): 468537
Entry
468537            CDS       T01005                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04310  Wnt signaling pathway
ptr04350  TGF-beta signaling pathway
ptr04371  Apelin signaling pathway
ptr04390  Hippo signaling pathway
ptr04520  Adherens junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04659  Th17 cell differentiation
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    468537 (SMAD4)
   04350 TGF-beta signaling pathway
    468537 (SMAD4)
   04390 Hippo signaling pathway
    468537 (SMAD4)
   04371 Apelin signaling pathway
    468537 (SMAD4)
   04068 FoxO signaling pathway
    468537 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    468537 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    468537 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    468537 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    468537 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    468537 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    468537 (SMAD4)
   05212 Pancreatic cancer
    468537 (SMAD4)
   05225 Hepatocellular carcinoma
    468537 (SMAD4)
   05226 Gastric cancer
    468537 (SMAD4)
   05220 Chronic myeloid leukemia
    468537 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    468537 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    468537 (SMAD4)
   05161 Hepatitis B
    468537 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 468537
NCBI-ProteinID: XP_001155601
Ensembl: ENSPTRG00000010028
VGNC: 13288
UniProt: A0A6D2X8J1 H2QEJ6
LinkDB
Position
18
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcgtcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcaacagcaggcggctactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cataccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system