KEGG   Pan troglodytes (chimpanzee): 468655Help
Entry
468655            CDS       T01005                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    468655 (TMPRSS9)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     468655 (TMPRSS9)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   468655 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 468655
NCBI-ProteinID: XP_016790139
Ensembl: ENSPTRG00000010236
VGNC: 2218
LinkDB All DBs
Position
19
AA seq 1093 aa AA seqDB search
MEPTVADVHLVPRTTKEIPALDAACCRAATIGVVATSLVVLTLGVLLAFLSIQGFHVDHT
AELRGIRWTSSLRRETSDYHRTLTPTLEALFVSSFQKTELEASCVGCSVLNYRDGNSSVL
VHFQLHFLLRPLQTLSLGLEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAE
REFKSGRCPGNSFSCGNSQCVTKVNPECDDQEDCSDGSDEVHCECGLQPAWRMAGRIVGG
VEASPGEFPWQASLRENKEHFCGAAIINARWLVSAAHCFNEFQDPTEWVAYVGATYLSGS
EASTVRARVAQIVKHPLYNADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPPSKKC
LISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEATTKASMPLAPTV
APAPAAPSTAWPTSPESPVVSTPTKSMQALSTVPLDWVTVPKLQECGARPAMEKPTRVVG
GFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLGTASLLGL
GGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLATQKFPVGRKC
MISGWGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRMICAGFLEGKVDSCQGD
SGGPLACEEAPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMSSQPLPVSPSS
TTRMLATTSPRTTAGLTVLGATPSRPTPGAASRVTGQPANSTLSAVSTTARGQTPFPDAP
EATTHSQLPDCGLAPAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSA
AHCFDVYGDPKQWAAFLGTPFLSGAEGQLERVARIYKHPFYNLYTLDYDVALLELAGPVR
RSRLVRPICLPEPAPRPPDGTRCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPV
QISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRV
AAVRGWIGQHIQE
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgtggctgacgtacacctcgtgcccaggacaaccaaggaaatccccgct
ctggatgccgcgtgctgtcgagcggccaccattggcgtggtggccaccagccttgtcgtc
ctcaccctgggagtccttttggccttcctctctatacagggcttccacgtggaccacacg
gccgagctgcggggaatccggtggaccagcagtttgcggcgggagacctcggactatcac
cgcacgctgacgcccaccctggaggcactgtttgtaagtagttttcagaagacagagtta
gaggcaagctgcgtgggttgctcggtgctgaattacagggatgggaactccagtgtcctc
gtacatttccagctgcactttctgctgcgacccctccagacgctgagcctgggcctggag
gaggagctattgcagcgagggatccgggcaaggctgcgggagcacggcatctccctggct
gcctatggcacaattgtgtcggccgagctcacagggagacataagggacccttggcagaa
agggagttcaaatcaggccgctgtccagggaactccttttcctgcgggaacagccagtgt
gtgaccaaggtgaacccagagtgtgacgaccaggaggactgctccgatgggtccgacgag
gtgcactgcgagtgtggcttgcagcctgcctggaggatggctggcaggatcgtgggcggc
gtggaagcgtccccgggggagtttccgtggcaagccagccttcgagagaacaaggagcac
ttctgtggggccgccatcatcaacgccaggtggctggtgtctgccgctcactgcttcaat
gagttccaagacccgacggagtgggtggcctacgtgggtgcgacctacctcagcggctcg
gaggccagcaccgtacgggcccgggtggcccagatcgtcaagcaccccctgtacaacgcg
gacacggctgacttcgacgtggcggtgctggagctgaccagccctctgcctttcggccgg
cacatccagcccgtgtgcctcccggctgccacacacatcttcccacccagcaagaagtgc
ctgatctcaggctggggctacctcaaggaggacttcctggtcaagccagaggtgctgcag
aaagccactgtggagctgctggaccaggcactgtgtgccagcctgtacggccactcactc
actgacaggatggtgtgcgctggctacctggacgggaaggtggactcctgccagggtgac
tcaggaggacccctggtctgcgaggagccctctggccggttctttctggctggcatcgtg
agctggggaatcgggtgtgcggaagcccggcgtccaggggtctatgcgcgagtcaccagg
ctacgtgactggatcctggaggccaccaccaaagccagcatgcctctggcccccacggtg
gctcctgcccctgccgcccccagcacagcctggcccaccagtcctgagagccctgtggtc
agcacccccaccaaatccatgcaggccctcagcaccgtgcctcttgactgggtcaccgtt
cctaagctacaagaatgtggggccaggcctgcaatggagaagcccacccgggtcgtgggc
gggttcggagctgcctccggggaggtgccctggcaggtcagcctgaaggaagggtcccgg
cacttctgcggagcaaccgtggtgggggaccgctggctgctgtctgccgcccactgcttc
aaccacacgaaggtggagcaggttcgggcccacctgggcactgcgtccctcctgggcctg
ggcgggagcccggtgaagatcgggctgcggcgggtagtgctgcaccccctctacaaccct
ggcatcctggacttcgacctggctgtcctggagctggccagccccctggccttcaacaaa
tacatccagcctgtctgcctgcccctggccacccagaagttccctgtgggccggaagtgc
atgatctccggatggggaaatacgcaggaaggaaatgccaccaagcccgagctcctgcag
aaggcgtctgtgggcatcatagaccagaaaacctgtagtgtgctctacaacttctccctc
acagaccgcatgatctgcgcaggcttcctggaaggcaaagtcgactcctgccagggtgac
tctgggggccccctggcctgcgaggaggcccctggcgtgttttatctggcagggatcgtg
agctggggtattggctgtgctcaggttaagaagccaggcgtgtacacgcgcatcaccagg
ctaaagggctggatcctggagatcatgtcctcccagccccttcccgtgtctccctcctcg
accacaaggatgctggccaccaccagccccaggacgacagctggcctcacagtcctgggg
gccacacccagcagacccacccctggggctgccagcagggtgacgggccaacctgccaac
tcaaccttatctgccgtgagcaccactgctaggggacagacgccatttccagacgccccg
gaggccaccacacactcccagctaccagactgtggcctggcgccggccgcgctcaccagg
attgtgggcggcagcgcagcgggccgtggggagtggccgtggcaggtgagcctgtggctg
cggcgccgggaacaccgttgcggggccgtgctggtggcagagaggtggctgctgtcggcg
gcgcactgcttcgacgtctacggggaccccaagcagtgggcggccttcctaggcacgccg
ttcctgagcggcgcggaggggcagctggagcgcgtggcgcgcatctacaagcacccgttc
tacaatctctacacgctcgactacgacgtggcgctgctggagctggcagggccggtgcgt
cgcagccgcctggtgcgtcccatctgcctacccgagcccgcgccgcgacccccagacggc
acgcgctgcgtcatcactggctggggctcggtgcgcgaaggaggctccatggcgcggcag
ctgcagaaggcggccgtgcgcctcctcagcgagcagacctgccgccgcttctacccagtg
cagatcagcagccgcatgctgtgtgccggcttcccgcagggtggcgtggacagctgctcg
ggtgacgctgggggacccctggcctgcagggagccctctggacggtgggtgctaactggg
gtcaccagctggggctatggctgtggccggccccacttcccaggtgtctatacccgggtg
gcagctgtgagaggttggataggacagcacatccaggagtga

DBGET integrated database retrieval system