KEGG   Pan troglodytes (chimpanzee): 468936Help
Entry
468936            CDS       T01005                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03030  DNA replication
ptr03410  Base excision repair
ptr03420  Nucleotide excision repair
ptr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    468936 (LIG1)
   03410 Base excision repair
    468936 (LIG1)
   03420 Nucleotide excision repair
    468936 (LIG1)
   03430 Mismatch repair
    468936 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptr03032]
    468936 (LIG1)
   03400 DNA repair and recombination proteins [BR:ptr03400]
    468936 (LIG1)
Enzymes [BR:ptr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     468936 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     468936 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     468936 (LIG1)
DNA replication proteins [BR:ptr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    468936 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     468936 (LIG1)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     468936 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     468936 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     468936 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685 DDR
Motif
Other DBs
NCBI-GeneID: 468936
NCBI-ProteinID: XP_016791863
Ensembl: ENSPTRG00000011225
VGNC: 10202
LinkDB All DBs
Position
19
AA seq 897 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEAETPKESLTEAEVATEKEGEDRDQ
ATTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPRTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELDEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLPCRVDQETVQSGGGRRLHRGSLGLDRRSLHPASAGG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaatagcagcagagagacggagccccctccaaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccggtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccctggactgctcacaggtctccccgccccgtcctgccacatctcctgaa
aacaatgcttccctctctgacacctctcccatggacagttccccatcagggattccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgaggatgaggacagagaagccaagaggaagaaggaggaggaagaagcggagaccccg
aaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
gccaccacgcctcccaagcccctaaagacctccaaagcagagaccccgacggaaagcgtt
tcagagcctgaggtggccacgaagcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagagctcccaggacgctcagcagcttcttcaccccccggaagccagcaatcaaa
aaagaagtgaaggaagaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggatccatccggttacaatcctgccaagaacaactatcatcccgtggaagatgcctgc
tggaaaccgggccagaaggttccttacctggccgtggcccggacgtttgagaagatcgag
gaggtgtctgctcggctccggatggtggagacgctgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctctacctcagcctcaaccaccttgggcca
ccccagcagggcctggagcttggcgtgggtgatggtgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtccgtccgggctgaggcagccgagaaaggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcctctggggtcttcagcaagttccgcgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgccttgggctggcagagcagtcggtgctg
gctgccctctcccaggcagtgagcctcacgcccccgggccaagaattcccaccagccgtg
gtggatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacgttctgcgaggttcccgacctggaccgaattatccccgtgctg
ctggagcatggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacccggggcgtcagcgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatatgacgggcagagggcacagatccatgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactgggaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacacc
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaggtggatgcatccgagatccaggtgcaggtgtgtttgtacgctttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacagagggcgagtttgtcttcgccacctccctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgttgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggctggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggacgagcatcaccagagcctcaaggccctggtgctgcccagccca
cgcccttacgtgcggatagatggcgctgtgattcccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgcgctgacctctccctctcccccatctaccctgctgcgcggggc
ctgccctgtcgtgtggatcaggaaacagtccagagtggaggagggaggagactgcacagg
gggtcgctggggctggaccgcaggagtctccatcccgcttctgcaggtggatag

DBGET integrated database retrieval system