KEGG   Pan troglodytes (chimpanzee): 469397Help
Entry
469397            CDS       T01005                                 

Gene name
AMY1A
Definition
(RefSeq) alpha-amylase 1 precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00500  Starch and sucrose metabolism
ptr01100  Metabolic pathways
ptr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    469397 (AMY1A)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    469397 (AMY1A)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     469397 (AMY1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Motif
Other DBs
NCBI-GeneID: 469397
NCBI-ProteinID: NP_001103627
Ensembl: ENSPTRG00000023940
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MKLFWLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNRRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttttggttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacgaacgtctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctccgaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctgtctggtctt
cttgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcgacgaggacat
ggggctggaggagcctctatacttaccttctgggatgctaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaagatgttaatgattgggttgggccaccaaataataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaactgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgcagaatctaaattgtaa

DBGET integrated database retrieval system