KEGG   Pan troglodytes (chimpanzee): 469538
Entry
469538            CDS       T01005                                 

Gene name
FCER1A
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit alpha
  KO
K08089  high affinity immunoglobulin epsilon receptor subunit alpha
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    469538 (FCER1A)
   04071 Sphingolipid signaling pathway
    469538 (FCER1A)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    469538 (FCER1A)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    469538 (FCER1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 Ig_5 I-set Izumo-Ig Ig_6 C2-set Adeno_E3_CR1 C1-set TadE Tad
Other DBs
NCBI-GeneID: 469538
NCBI-ProteinID: XP_009433534
Ensembl: ENSPTRG00000001523
VGNC: 6817
UniProt: H2Q0C9
LinkDB
Position
1
AA seq 260 aa
MKNMAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFF
EVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQA
SAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCT
GKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVAILFAVDTGLFISTQQQVTFLLKIK
RTRKGFRLLTPHPTPNPKNN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaagaatatggctcctgccatggaatcccctactctgctgtgtgtagccttactgttc
ttcgctccagatggcgtgttagcagtccctcagaaacctaaggtctccttgaaccctcca
tggaatagaatatttaaaggagagaatgtgactcttacatgtaatgggaacaatttcttt
gaagtcagttccaccaaatggttccacaatggcagcctttcagaagagacaaattcaagt
ttgaatattgtgaatgccaaatttgaggacagtggagaatacaaatgtcagcaccaacaa
gttaatgagagtgaacctgtgtacctggaagtcttcagtgactggctgctccttcaggcc
tctgctgaggtggtgatggagggtcagcccctcttcctcaggtgccatggttggaggaac
tgggatgtgtacaaggtgatctattataaggatggtgaagctctcaagtactggtatgag
aaccacaacatctccattacaaatgccacagttgaagacagtggaacctactactgtacg
ggcaaagtgtggcagctggactatgagtctgagcccctcaacattactgtaataaaagct
ccgcgtgagaagtactggctacaattttttatcccattgttggtggcgattctgtttgct
gtggacacaggattatttatctcgactcagcagcaggtcacatttctcttgaagattaag
agaaccaggaaaggcttcagacttctgaccccacatcctacgccaaaccccaaaaacaac
tga

DBGET integrated database retrieval system