KEGG   Pan troglodytes (chimpanzee): 469616Help
Entry
469616            CDS       T01005                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00590  Arachidonic acid metabolism
ptr01100  Metabolic pathways
ptr04064  NF-kappa B signaling pathway
ptr04370  VEGF signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04657  IL-17 signaling pathway
ptr04668  TNF signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04726  Serotonergic synapse
ptr04913  Ovarian steroidogenesis
ptr04921  Oxytocin signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr05140  Leishmaniasis
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05200  Pathways in cancer
ptr05204  Chemical carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    469616 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    469616 (PTGS2)
   04064 NF-kappa B signaling pathway
    469616 (PTGS2)
   04668 TNF signaling pathway
    469616 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    469616 (PTGS2)
   04657 IL-17 signaling pathway
    469616 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    469616 (PTGS2)
   04913 Ovarian steroidogenesis
    469616 (PTGS2)
   04921 Oxytocin signaling pathway
    469616 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    469616 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    469616 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    469616 (PTGS2)
   05206 MicroRNAs in cancer
    469616 (PTGS2)
   05204 Chemical carcinogenesis
    469616 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    469616 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    469616 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    469616 (PTGS2)
   05165 Human papillomavirus infection
    469616 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    469616 (PTGS2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     469616 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 469616
NCBI-ProteinID: XP_524999
Ensembl: ENSPTRG00000001786
VGNC: 6970
UniProt: H2Q0S9
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEFFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattacttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggagttctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtatcaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system