KEGG   Pan troglodytes (chimpanzee): 470683
Entry
470683            CDS       T01005                                 

Gene name
INPP5D
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 isoform X1
  KO
K03084  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 [EC:3.1.3.86]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr04070  Phosphatidylinositol signaling system
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    470683 (INPP5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    470683 (INPP5D)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    470683 (INPP5D)
   04664 Fc epsilon RI signaling pathway
    470683 (INPP5D)
   04666 Fc gamma R-mediated phagocytosis
    470683 (INPP5D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    470683 (INPP5D)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     470683 (INPP5D)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    470683 (INPP5D)
SSDB
Motif
Pfam: SH2 Exo_endo_phos
Other DBs
NCBI-GeneID: 470683
NCBI-ProteinID: XP_016806215
Ensembl: ENSPTRG00000013050
VGNC: 50731
UniProt: A0A6D2X7W6 H2QJM6
LinkDB
Position
2B
AA seq 1189 aa
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESV
VSPPELPPRNIPLTASSCEAKEVSFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEH
LKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQ
PLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRRSLIPPVT
FEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL
VETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
KITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTV
AIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNS
HLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAE
TIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQK
ATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKF
GETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
GELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAP
PCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGES
PPTPPGQPPISPKKFLPSTANRGLPARTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENP
LYGSLSSFPKPAPRKDQESPKMPRKEPLPCPEPGILSPSIVLTKAQEADRGEGPGKQVPA
PRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPR
PPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ
NT seq 3570 nt   +upstreamnt  +downstreamnt
atggtcccctgctggaaccacggcaacatcacccgctccaaggcggaggagctgctttcc
aggacgggcaaggacgggagcttcctcgtgcgtgccagcgagtccatctcccgggcatac
gcgctctgcgtgctgtatcggaattgcgtttacacttacagaattctgcccaatgaagac
gataaattcactgttcaggcatccgaaggcgtctccatgaggttcttcaccaagctggac
cagctcatcgagttttacaagaaggaaaacatggggctggtgacccatctgcaataccct
gtgccgctggaggaagaggacacaggcgacgaccctgaggaggacacagtagaaagtgtc
gtgtctccacccgagctgcccccaagaaacatcccgctgactgccagctcctgtgaggcc
aaggaggtttctttttcaaacgagaatccccgagcgaccgagaccagccggccgagcctc
tccgagacattgttccagcgactgcaaagcatggacaccagtgggcttccagaagagcat
cttaaggccatccaagattatttaagcactcagctcgcccaggactctgaatttgtgaag
acggggtccagcagtcttcctcacctgaagaaactgaccacactgctctgcaaggagctc
tatggagaagtcatccggaccctcccatccctggagtctctgcagaggttatttgaccag
ccgctctccccgggcctccgtccacgtcctcaggttcctggtgaggccaatcccatcaac
atggtgtccaagctcagccaactgacaagcctgttgtcgtctattgaagacaaggtcaag
gccttgctgcacgagggtcctgagtctccgcaccggcgctcccttatccctccagtcacc
tttgaggtgaaggcagagtctctggggattcctcagaaaatgcagctcaaagtcgacgtt
gagtctgggaaactgatcattaagaagtccaaggatggttctgaggacaagttctacagc
cacaagaaaatcctgcagctcattaagtcacagaaatttctgaataagttggtgatcttg
gtggaaacagagaaggagaagatcctgcggaaggaatatgtttttgctgactccaaaaag
agagaaggcttctgccagctcctgcagcagatgaagaacaagcactcagagcagccggag
cccgacatgatcaccatcttcatcggcacctggaacatgggtaacgccccccctcccaag
aagatcacgtcctggtttctctccaaggggcagggaaagacgcgggacgactctgccgac
tacatcccccatgacatttacgtgatcggcacccaagaggaccccctgagtgagaaggag
tggctggagatcctcaaacactccctgcaagaaatcaccagcgtgacttttaaaacagtc
gccatccacacgctctggaacatccgcatcgtggtgctggccaagcctgagcacgagaac
cggatcagccacatctgtactgacaacgtgaagacaggcattgcaaacacactggggaac
aagggagccgtgggggtgtcgttcatgttcaatggaacctccttagggttcgtcaacagc
cacttgacttcaggaagtgaaaagaaactcaggcgaaaccaaaactatatgaacattctc
cggttcctggccctgggcgacaagaagctgagtccctttaacatcactcaccgcttcacg
cacctcttctggtttggggatcttaactaccgtgtggatctgcctacctgggaggcagaa
accatcatccagaaaatcaagcagcagcagtacgcagacctcctgtcccacgaccagctg
ctcacagagaggagggagcagaaggtcttcctacacttcgaggaggaagaaatcacgttt
gccccaacctaccgttttgagagactgactcgggacaaatacgcctacaccaagcagaaa
gcgacagggatgaagtacaacttgccttcctggtgtgaccgagtcctctggaagtcttat
cccctggtgcacgtggtgtgtcagtcttatggcagtaccagcgacatcatgacgagtgac
cacagccctgtctttgccacatttgaggcaggagtcacttcccagtttgtctccaagaat
ggtcccgggactgttgacagccaaggacagattgagtttctcaggtgctatgccacattg
aagaccaagtcccagaccaaattctacctggagttccactcgagctgcttggagagtttt
gtcaagagtcaggaaggagaaaatgaagaaggaagtgagggggagctggtggtgaagttt
ggtgagactcttccaaagctgaagcccattatctctgaccctgagtacctgctagaccag
cacatcctcatcagcatcaagtcctctgacagcgacgaatcctatggcgagggctgcatt
gcccttcggttagaggccacagaaacgcagctgcccatctacacgcctctcacccaccat
ggggagctgacaggccacttccagggggagatcaagctgcagacctctcagggcaagacg
agggagaagctctatgactttgtgaagacggagcgtgatgaatccagtgggccaaagacc
ctgaagagcctcaccagccacgaccccatgaagcagtgggaagtcaccagcagggcccct
ccgtgcagtggctccagcatcactgaaatcatcaaccccaactacatgggagtggggccc
tttgggccaccaatgcccctgcacgtgaagcagaccttgtcccctgaccagcagcccaca
gcctggagctacgaccagccgcccaaggattccccgctggggccctgcaggggagaaagt
cccccgacacctcccggccagccgcccatatcacccaagaagtttttaccctcaacagca
aaccggggtctccccgccaggacacaggagtcaaggcccagtgacctggggaagaacgca
ggggacacgctgcctcaggaggacctgccgctgacgaagcccgagatgtttgagaacccc
ctgtatgggtccctgagttccttccctaagcctgctcccaggaaggaccaggaatccccc
aaaatgccgcggaaggaacccctgccctgcccggaacccggcatcttgtcgcccagcatc
gtgctcaccaaagcccaggaggctgatcgcggcgaggggcccggcaagcaggtgcccgcg
ccccggctgcgctccttcacgtgctcatcctctgccgagggcagggcggccggcggggac
aagagccaagggaagcccaagaccccggtcagctcccaggccccggtgccggccaagagg
cccatcaagccttccagatcggaaatcaaccagcagaccccgcccaccccgacgccgcgg
ccgccgctgccagtcaagagcccggcggtgctgcacctccagcactccaagggccgcgac
taccgcgacaacaccgagctcccgcatcacggcaagcaccggccggaggaggggccacca
gggcctctaggcaggactgccatgcagtga

DBGET integrated database retrieval system