KEGG   Pan troglodytes (chimpanzee): 471626
Entry
471626            CDS       T01005                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04664  Fc epsilon RI signaling pathway
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05221  Acute myeloid leukemia
ptr05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    471626 (IL3)
   04151 PI3K-Akt signaling pathway
    471626 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    471626 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    471626 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471626 (IL3)
   04664 Fc epsilon RI signaling pathway
    471626 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    471626 (IL3)
   05202 Transcriptional misregulation in cancer
    471626 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    471626 (IL3)
  09163 Immune disease
   05310 Asthma
    471626 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    471626 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    471626 (IL3)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   471626 (IL3)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Haparin
  Cytokines
   471626 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 471626
NCBI-ProteinID: NP_001129106
Ensembl: ENSPTRG00000017211
VGNC: 4044
UniProt: Q28809
LinkDB
Position
5
AA seq 152 aa
MSRLPVLLLLQLLVRPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIRIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccgtatcaaggat
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatcttttga

DBGET integrated database retrieval system