KEGG   Pan troglodytes (chimpanzee): 471627
Entry
471627            CDS       T01005                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04650  Natural killer cell mediated cytotoxicity
ptr04657  IL-17 signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr05146  Amoebiasis
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05171  Coronavirus disease - COVID-19
ptr05202  Transcriptional misregulation in cancer
ptr05221  Acute myeloid leukemia
ptr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    471627 (CSF2)
   04668 TNF signaling pathway
    471627 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    471627 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    471627 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    471627 (CSF2)
   04660 T cell receptor signaling pathway
    471627 (CSF2)
   04657 IL-17 signaling pathway
    471627 (CSF2)
   04664 Fc epsilon RI signaling pathway
    471627 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    471627 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    471627 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    471627 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471627 (CSF2)
   05171 Coronavirus disease - COVID-19
    471627 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    471627 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    471627 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ptr03019]
    471627 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    471627 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    471627 (CSF2)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     471627 (CSF2)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  CSF and other factors
   471627 (CSF2)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Cytokines
   471627 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 471627
NCBI-ProteinID: XP_527005
Ensembl: ENSPTRG00000017212
VGNC: 6847
UniProt: H2QRG1 A0A6D2X6Y2
LinkDB
Position
5
AA seq 144 aa
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVV
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPLDCWEPVQE
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagttgtc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatccccttggactgctgggag
ccagtccaggagtga

DBGET integrated database retrieval system