KEGG   Pan troglodytes (chimpanzee): 471734
Entry
471734            CDS       T01005                                 

Gene name
LCP2
Definition
(RefSeq) lymphocyte cytosolic protein 2 isoform X1
  KO
K07361  lymphocyte cytosolic protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04015  Rap1 signaling pathway
ptr04380  Osteoclast differentiation
ptr04611  Platelet activation
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    471734 (LCP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    471734 (LCP2)
   04650 Natural killer cell mediated cytotoxicity
    471734 (LCP2)
   04660 T cell receptor signaling pathway
    471734 (LCP2)
   04664 Fc epsilon RI signaling pathway
    471734 (LCP2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    471734 (LCP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    471734 (LCP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    471734 (LCP2)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   471734 (LCP2)
SSDB
Motif
Pfam: SH2 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 471734
NCBI-ProteinID: XP_001150122
Ensembl: ENSPTRG00000017517
VGNC: 4067
UniProt: A0A6D2WUQ6 A0A2I3S4L7
LinkDB
Position
5
AA seq 533 aa
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRPLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNSLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcactgaggaatgtgccctttcgctcagaggtcctgggctgggaccccgacagcctt
gctgactatttcaagaagctcaactataaggactgtgagaaggcagtgaagaagtaccac
atcgatggggctcgcttcttgaacctgacagaaaatgacatccagaagttccccaagctc
cgggtgccgattctcagtaagttaagtcaggaaatcaacaagaacgaagagaggaggagc
atcttcacacgcaaaccccaagtcccgcggtttcctgaagagacagaaagccacgaagag
gacaatgggggctggtcgtcctttgaagaagacgattatgaaagtcccaatgatgaccag
gatggcgaggatgatggagactatgagtcccccaatgaggaggaagaggcacccgtggaa
gatgacgcggattatgagccgccaccctccaatgacgaggaagctctgcagaactccatc
ctgcctgccaagcctttccccaactccaactccatgtacatcgaccggcccccctctggg
aaaaccccccagcagcctcctgtgcccccccagagaccgatggccgccctcccgccccca
ccagccggccggaatcactcgccactgcccccaccccagaccaaccacgaagaacccagc
agaagcagaaaccacaaaacggcaaagctccctgctccttcaatagacagaagcacgaaa
cctcccctagatcgttcattagctccgtttgatagagaacccttcacactaggaaagaaa
ccaccattttctgacaagccctcgattccagcgggaaggccactcggggagcatttaccc
aagattcaaaagcctcctttaccaccgaccacggaaagacatgaaaggagcagccccctg
ccagggaaaaagccacctgtgccaaagcatggatggggaccagacagaagagagaatgat
gaagatgatgtgcatcaaagacctttgccccagccagcactacttcctatgagctccaac
actttcccttcaagatctactaagccaagtcccatgaactctctcccatcctctcacatg
cctggagcattctcagaaagtaacagcagttttccacagagtgcctccctgccgccatac
ttctctcaaggccctagcaacagaccacctatcagagccgaaggcagaaacttccccttg
ccacttccaaacaaacctcggcccccatcccctgcggaggaagagaattcattaaatgaa
gagtggtacgtttcttatattacccgaccagaggcagaagctgctcttagaaagataaac
caggatggcacatttctggttagagacagctctaaaaaaacaaccaccaatccatatgtc
ctcatggtgttgtacaaagataaagtttacaacatccagatccgttatcagaaggaaagt
caagtttacttgttgggaactggactccgagggaaagaggactttctgtctgtgtcagat
attattgactacttcaggaaaatgccacttctgctcattgatgggaaaaaccgaggttcc
agataccagtgcacattaacgcatgctgcagggtacccatag

DBGET integrated database retrieval system