KEGG   Pan troglodytes (chimpanzee): 472029
Entry
472029            CDS       T01005                                 

Gene name
IL17A
Definition
(RefSeq) interleukin-17A
  KO
K05489  interleukin 17A
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
ptr04659  Th17 cell differentiation
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    472029 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    472029 (IL17A)
   04657 IL-17 signaling pathway
    472029 (IL17A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    472029 (IL17A)
   05321 Inflammatory bowel disease
    472029 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    472029 (IL17A)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   472029 (IL17A)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 472029
NCBI-ProteinID: XP_527408
Ensembl: ENSPTRG00000018273
VGNC: 3123
UniProt: A0A6D2WYW0 H2QT64
LinkDB
Position
6
AA seq 155 aa
MTPGKTSLVSLLLLLSLEAIVKAGIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
NT seq 468 nt   +upstreamnt  +downstreamnt
atgactcctgggaagacctcattggtgtcactgctactgctgctgagcctggaggccata
gtgaaggcaggaatcgcaatcccacgaaatccaggatgcccaaattctgaggacaagaac
ttcccccggactgtgatggtcaacctgaacatccataaccggaataccaataccaatccc
aaaaggtcctcagattactacaaccgatccacctcaccttggaatctccaccgcaatgag
gaccctgagagatatccctctgtgatctgggaggcaaagtgccgccacttgggctgcatc
aacgctgatgggaacgtggactaccacatgaactctgtccccatccagcaagagatcctg
gtcctgcgcagggagcctccacactgccccaactccttccggctggagaagatactggtg
tccgtgggctgcacctgtgtcaccccgattgtccaccatgtggcctaa

DBGET integrated database retrieval system