KEGG   Pan troglodytes (chimpanzee): 472030
Entry
472030            CDS       T01005                                 

Gene name
IL17F
Definition
(RefSeq) interleukin-17F
  KO
K05494  interleukin 17F
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
ptr04659  Th17 cell differentiation
ptr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    472030 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    472030 (IL17F)
   04657 IL-17 signaling pathway
    472030 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    472030 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    472030 (IL17F)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   472030 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 472030
NCBI-ProteinID: XP_527409
Ensembl: ENSPTRG00000018274
VGNC: 3124
UniProt: A0A2J8P0Z7
LinkDB
Position
6
AA seq 163 aa
MTVKTLHGPAMVKYLLLLILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGDSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTRDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacagtgaagaccctgcatggcccagccatggtcaagtacttgctgctgttgatattg
gggcttgcctttctgagtgaggcggcagctcggaaaatccccaaagtaggacatactttt
ttccaaaagcctgagagttgcccgcctgtgccaggagatagtatgaaacttgacattggc
atcatcaatgaaaaccagcgtgtttccatgtcacgtaacatcgagagccgctccacctcc
ccctggaattacactgtcactcgggaccccaaccggtacccctcggaagttgtacaggcc
cagtgtaggaacttgggctgcatcaatgctcaaggaaaggaagacatctccatgaattcc
gttcccatccagcaagagaccctggtcgtccggaggaagcaccaaggctgctctgtttct
ttccagttggagaaggtgctggtgactgttggctgcacctgcgtcacccctgtcatccac
catgtgcagtaa

DBGET integrated database retrieval system