KEGG   Pan troglodytes (chimpanzee): 472771
Entry
472771            CDS       T01005                                 

Gene name
LYN
Definition
(RefSeq) tyrosine-protein kinase Lyn isoform X3
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04611  Platelet activation
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04730  Long-term depression
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    472771 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    472771 (LYN)
   04662 B cell receptor signaling pathway
    472771 (LYN)
   04664 Fc epsilon RI signaling pathway
    472771 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    472771 (LYN)
   04062 Chemokine signaling pathway
    472771 (LYN)
  09156 Nervous system
   04730 Long-term depression
    472771 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    472771 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    472771 (LYN)
   05169 Epstein-Barr virus infection
    472771 (LYN)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     472771 (LYN)
Protein kinases [BR:ptr01001]
 Non-receptor tyrosine kinases
  SRC family
   472771 (LYN)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    472771 (LYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_3
Other DBs
NCBI-GeneID: 472771
NCBI-ProteinID: XP_003311845
Ensembl: ENSPTRG00000020263
VGNC: 8181
UniProt: K7AHF5
LinkDB
Position
8
AA seq 491 aa
MGCIKSKGKDSLSDDGVDLKTQPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDD
LSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAER
QLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITF
PCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEV
WMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEY
MAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMC
KIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGK
IPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFY
TATEGQYQQQP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgagtgacgatggagtagatttgaag
actcaaccagttccagaatctcagcttttacctggacagaggtttcaaactaaagatcca
gaggaacaaggagacattgtggtagccttgtacccctatgatggcatccacccggacgac
ttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtggaaa
gcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaactc
aacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaaagg
cagcttttggcaccaggaaatagcgctggagctttccttattagagaaagtgaaacatta
aaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggtgatgttattaag
cactacaaaattagaagtctggataatgggggctattacatctctccacgaatcactttt
ccctgtatcagcgacatgattaaacattaccaaaagcaggcagatggcttgtgcagaaga
ttggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgggag
atcccccgggagtccatcaagttggtgaaaaggcttggcgctgggcagtttggggaagtc
tggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccaggaact
atgtctgtgcaagccttcctggaagaagccaacctcatgaagaccctgcagcatgacaag
ctcgtgaggctctatgctgtggtcaccagggaggagcccatttacatcatcaccgagtac
atggccaagggcagtttgttggatttcctgaaaagcgatgaaggtggcaaagtgctgctt
ccaaagctcattgacttttctgctcagattgcagagggaatggcatacatcgagcggaag
aactacattcaccgggacctgcgagcagctaatgttctggtctccgagtcactcatgtgc
aaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagggaa
ggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttcact
attaagtctgatgtgtggtcctttggaatcctcctatacgaaatcgtcacctatgggaaa
attccctacccagggagaactaatgccgacgtgatgaccgccctttcccagggctacagg
atgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctggaaa
gaaaaggcagaagagagaccaacgtttgattacttacagagcgtcctggatgatttctac
acagccacggaagggcaataccagcagcagccttag

DBGET integrated database retrieval system