KEGG   Pan troglodytes (chimpanzee): 473295Help
Entry
473295            CDS       T01005                                 

Gene name
SETD1B
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    473295 (SETD1B)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     473295 (SETD1B)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     473295 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     473295 (SETD1B)
    COMPASS/SET1 complex (yeast)
     473295 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 473295
NCBI-ProteinID: XP_016779911
Ensembl: ENSPTRG00000005567
VGNC: 5580
UniProt: A0A2I3RBF6
LinkDB All DBs
Position
12
AA seq 1962 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPAVTFKARRHESKFTDAYNRRHEHHYVHNSPAVTAVAGATAAFRGSSDLPFGAVGGT
GGSSGPPFKAQPQDSATFAHTPPPAQATPAPGFKSAFSPYQTPVAHFPPPPEEPTATAAF
GARDSGEFRRVPAPPPLPPAEPLAKEKPGTPPGPPPPDTNSMELGGRPTFGWSPEPCDSP
GTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLLFLREPDSDTELQMEGSPISSSSSQL
SPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDEELDLGLGPRPPPEPGP
PDPAGLLSQTAEVALDLVGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPM
VVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAH
PAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQ
VLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKF
DPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKK
ERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLP
SFKVKRKEPPDTTSSGDQKRLRPSTSVDEEDEESERERDRDMADTPCDLAKRDPKGVGVR
RRPARPLELDSGGEEDEKESLSASSSSSASSSSGSSTTSPSSSASDKEEEQESTEEEEEA
EEVPRSQLSSSSTSSTSDKDDDDDDSDDRDESENDDEDTALSEASEKDEGDSDEEETVSI
VTSKAEATSSSESSQSSEFESSSESSPSSSEDEEEVVAREEEEEEEEEEAMVAEESMASA
GPEDFEQDGEEAALAPGAPAVDSLGMEEEVDIETEAVAPEERPSMLDKPPLPVGVEEPAD
SREPPEEPGLSQEGAMLLSPEPPAREVEAQPPLSPERAPEHDLEVEPEPPTMLPLPLQPP
LPPPRPPRPPSPPPEPETTDASHPSVPPEPLAEDHPPHTPGLCGSLAKSQSTETVPATPG
GEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLSSGGLPRTPGRDFSFTPTFSEPSGPLL
LPVCPLPTGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPAVLRAQARAPTPLPPLL
PAPLASCPPPMKRKPGRPRRSPPSVLSLDGPLVRPPAGAALGRELLLLPGQPQTPVFPST
HDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELDNQWPSEAIPPGPRG
RDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPELSPPQPLFRPRSEFEEMTILYDI
WNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVT
GCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRL
LSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQV
IADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKK
IVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5889 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctctg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagcctggcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtcgtcgggatctggaccaaaaac
aaggagctggagctgtcggtgcccaaattcaagatcgatgagttctacgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgtgaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacctgggcatcgccaaggtggtctttgccacggtccggggagccaaggatgcc
gttcagcacttgcacagcacttccgtcatgggcaacattatccacgtggagctggacacc
aaaggggaaacccgaatgcggttctatgaactgttggtcactggccgatacaccccccag
accctcccagtgggcgagctggatgctgtctctccaatcgtgaatgagaccctgcagctg
tcagatgccctgaagcgcctcaaggatggaggcctgtctgcaggctgtggctccggctcc
tcctctgtcacccccaatagcggtgggacacccttctcccaggacacagcttactccagc
tgccgcctggacacacccaactcctatggacagggcaccccgctcacacctcgcctgggc
acccctttctcacaggactccagctactccagccgccagcccacaccctcatacctcttc
agccaggaccctgcagtgaccttcaaggcccggcgccacgagagcaagttcacggacgcc
tacaaccgccgccacgaacatcattatgtacacaattctcccgcggtcactgcagtggcc
ggggccacagccgccttccggggttcctcggacctcccgttcggagcagtcggcggcact
gggggcagcagcggtccccccttcaaggctcaaccacaggattcagccacatttgcccac
actccaccacccgcccaagcaacccctgctcctggattcaagtctgctttctctccgtat
cagaccccagtggcccacttccctccacccccagaagagcccaccgccacagccgctttc
ggggcccgcgacagtggggagttccggagggtaccggcacccccacccctgccacctgct
gagcctctggccaaggagaagccaggcacgccacccggcccgccgccccccgacaccaac
agcatggagctgggcggccggcccaccttcggctggagtcctgagccctgtgacagccct
ggcacgcccacgctggagtcgtcccctgcagggccagagaaaccccacgacagcctggac
tcgcgcatcgagatgctgctgaaggagcagcgcaccaagctgctcttcctgcgggagccg
gactcggacaccgagctgcagatggagggcagccccatctcctcctcctcctcccagctc
tccccactggccccctttggcaccaactcccagccaggcttccggggccccacgcccccc
tcgtcacgcccctccagcaccggcctggaggacatcagcccaacaccccttccagactcc
gacgaggacgaggagctcgacctgggccttgggcctcggcctccacctgagccaggcccc
ccggaccctgctgggcttctgagccagacagctgaggtggccttggacctggttggagac
agaaccccgacctcagagaagatggatgagggccagcagtcctcaggcgaggacatggag
atctcggatgacgagatgccctcggcccccatcaccagcgccgactgccccaagcccatg
gtggtgaccccaggagcggcagccgtggcagccccttctgtgctagccccaaccctgccg
ctgcccccgccacctggcttccccccgctgcccccaccaccaccaccacccccaccgcag
cctggcttccccatgcccccaccgctgcccccaccgccgcccccaccccctccagcccac
cctgctgtgacagtgcccccaccacccttgccagcgccacctggagtcccgcccccaccc
atcctgccaccactgcccccctttccgccgggcctgttccctgtgatgcaggtggacatg
agccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatgcaaacgcag
gtgctcagccggctgatgacgggccagggcgcctgcccctacccacccttcatggccgct
gcggctgccgctgcctcagctgggctccagtttgtcaacctgccgccctaccggggcccc
ttctccctgagcaactctggcccaggccgcgggcagcactggccaccactgcccaagttt
gacccgtcagtgcctccaccaggctacatgccacgccaggaggacccacacaaagccacg
gtggatggcgtcctgctggtggtcctcaaagaactcaaggccatcatgaagcgtgacctg
aaccgcaagatggtggaagtggtggctttccgggcctttgacgagtggtgggacaagaag
gagcggatggccaaggcctcgctgaccccggtgaagtcgggcgagcacaaggacgaggac
aggccgaagcccaaggaccgcatcgcctcgtgcctgctggagtcatggggcaagggcgag
ggcctgggctacgagggcctgggcctgggcattgggctgcgtggggccattcgcctgccc
tccttcaaggtcaagaggaaggagccaccagacaccacctcatctggcgaccagaagcgg
ctgcggccctcgacctctgtggatgaggaagatgaagagtctgagcgagagcgagaccgg
gatatggcagacaccccctgtgatctcgccaagcgggaccccaagggcgtgggtgtgcgg
cggcggccggcgcggcctctggagctggacagtggtggggaggaggatgagaaggagtcg
ttgtcggcgtcctcgtcctcatcggcgtcatcatcctcggggtcctcaaccacctcaccc
tcgtcctcagcctccgacaaggaggaggaacaggagagcaccgaggaggaagaggaggcg
gaggaagtccccaggagccagctctcctcctcctcaacctcatccacatcagataaggat
gatgacgatgacgacagtgatgaccgggatgagtctgagaacgatgacgaagacacagcc
ctgtcagaggcgagtgagaaggacgaaggggactcggatgaagaggagacagtgagcatt
gtaacctccaaggccgaagccacgtcgtccagtgagagttcccagtcttctgagtttgag
tcaagctccgagtcctcgccctcatcctcggaggatgaggaggaggtagtggccagggaa
gaggaggaagaagaggaggaggaggaggcgatggtggccgaggaaagcatggcttctgca
ggccccgaggactttgagcaggacggggaggaagcggctctggccccgggggcacctgca
gtggactcgttgggcatggaagaggaggtggacatcgagactgaggctgtggcccctgag
gagcggccctccatgctggacaagccccccttgcctgtgggtgttgaagagccagcggac
tccagggagccccccgaggaaccaggcctgagccaggaaggggccatgttgctgtctcca
gagccccctgccagggaggtggaggctcaacccccattgtcccctgagcgagctccagaa
catgacctggaagtggagccggagccccctacgatgctccccttgcccctgcaaccacca
ttgccacccccacgaccaccccggccgcctagcccaccgccggagcctgagaccacagat
gcctcacacccatctgtccctccggagccccttgccgaggaccaccccccgcatactcca
ggcctctgtggcagcctggccaagtcgcagagcacagagacggtgccagccacaccaggc
ggggagcccccgctatcagggggcagcagtggcctgtccctgagctctccgcaagtgccc
ggcagccccttctcctacccagccccgtcccctagcttgagcagtgggggcctccctcgg
acacctggccgggacttcagcttcacacccaccttctccgagcccagcgggcccttgctc
ctgcccgtctgcccactccccactggccgacgcgatgaacgctccgggcccctggcctcc
ccggtgctcctggagacgggcctgcccctccctctgccccttcccctgcccttgcccttg
gcattgcccgccgtcttgcgggcccaggctcgtgcgcccaccccgctgccacccctgctg
cccgcccccctggcctcttgcccacccccaatgaagaggaagccgggccggccccggcga
tccccaccatctgtgctctccttggatgggcccttggtccgaccaccagcaggggccgcc
cttggaagggaactcctgctcctgccgggccagccacagacccccgtcttccccagcacc
catgacccccggacggtgaccctggacttccggaacgcggggatcccagcccctccacca
ccccttcccccccagccacccccacccccacctcccccacctgtagagcccaccaagctg
ccctttaaggagctagacaaccagtggccctccgaggccattcctccgggcccccgtggg
cgcgatgaggtcactgaggagtacatggagttggccaagagccgggggccgtggcgccgg
ccacctaagaagcgccatgaggacctggtgccacctgcgggctcgcccgaactctcgcca
ccccagcccctcttccggccccgctcggagtttgaggagatgaccatcctgtatgacatc
tggaacggtggcatcgacgaggaggacatccgcttcctgtgtgtcacctacgagcgactg
ctacagcaggacaatggcatggactggcttaacgacacgctctgggtctaccatccctcc
accagcctctcttcagctaagaaaaagaaacgggacgatggcatccgcgagcacgtgacg
ggctgtgcccgcagtgagggcttctacaccatcgacaagaaggacaagctcagatacctc
aacagcagccgtgccagcaccgatgagccccccgcagacacccagggcatgagcatccca
gcacagccccacgcctccacccgggcaggctcggagcggcgttcggagcagcgccgcctg
ctgtcctccttcactggcagctgtgacagcgacctgctcaagttcaaccagctcaagttc
cggaagaaaaagctcaagttctgcaagagccacattcacgactggggcttgttcgccatg
gagcccatcgcggctgacgagatggtcatcgagtacgtgggccagaatatccgtcaggtg
atcgcagacatgcgggagaagcgttatgaggacgagggcatcgggagcagctacatgttc
cgggtagaccacgacaccatcatcgacgccaccaagtgtggcaacttcgcgcgcttcatc
aaccacagctgcaaccctaactgctatgccaaggtgatcacggtggagtcacagaagaag
atagtcatctactcgaagcagcacattaacgtcaatgaggagattacctatgactataag
ttccccatcgaggacgtcaagatcccctgcctctgtggctccgagaactgccgggggacc
ctcaactag

DBGET integrated database retrieval system