KEGG   Pan troglodytes (chimpanzee): 474007Help
Entry
474007            CDS       T01005                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2 isoform X1
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05164  Influenza A
ptr05202  Transcriptional misregulation in cancer
ptr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    474007 (TMPRSS2)
   05215 Prostate cancer
    474007 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    474007 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    474007 (TMPRSS2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     474007 (TMPRSS2)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   474007 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 474007
NCBI-ProteinID: XP_001172064
Ensembl: ENSPTRG00000013928
VGNC: 3729
UniProt: A0A2J8M861
LinkDB All DBs
Position
21
AA seq 529 aa AA seqDB search
MPAAPPGGENGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPTAIGPYYENHGYQPE
NPYPAQPTVAPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVRMQPKSPSGTVCTSKTKK
ALCLTLTLGTFLVGAALAAGLLWNFMGSKCSNSGIECDSSGTCISPSNWCDGVSHCPSGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDD
SGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESAL
PGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYG
AGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLEPEQLCWISG
WGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGG
PLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQMRADS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgccccgcccggaggtgaaaacgggtgtgaggagcgcggcgcggcaggtcat
attgaacattccagatacctatcattactcgatgctgttgataacagcaagatggctttg
aactcagggtcaccaacagctattggaccttactatgaaaaccatggataccaaccggaa
aacccctatcccgcacagcccactgtggcccccactgtctacgaggtgcatccggctcag
tactacccgtcccccgtgccccagtacgccccgagggtcctgacgcaggcttccaacccc
gtcgtccgcatgcagcccaaatccccatccgggacagtgtgcacctcaaagactaagaaa
gcactgtgcctcaccttgaccctggggaccttcctcgtgggagctgcactggccgctggc
ctactctggaatttcatgggcagcaagtgctccaactctgggatagagtgcgactcctca
ggtacctgcatcagcccctctaactggtgtgatggcgtgtcacactgccccagcggggag
gacgagaatcggtgtgttcgcctctacggaccaaacttcatccttcaggtgtactcatct
cagaggaagtcctggcaccctgtgtgccaagacgactggaacgagaactacgggcgggcg
gcctgcagggacatgggctataagaataatttttactctagccaaggaatagtggatgac
agcggatccaccagctttatgaaactgaacacaagtgccggcaatgtcgatatctataaa
aaactgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgctgtatagcc
tgcggggtcaacttgaactcaagccgccagagcaggatcgtgggtggcgagagcgcgctc
ccgggggcctggccctggcaggtcagcctgcacgtccagaacgtccacgtgtgcggaggc
tccatcatcacccccgagtggatcgtgacagccgcccactgcgtggaaaaacctcttaac
aatccatggcattggacggcatttgcggggattttgagacaatctttcatgttctatgga
gccggataccaagtagaaaaagtgatttctcatccaaattatgactccaagaccaagaac
aatgacattgcgctgatgaagctgcagaagcctctgactttcaacgacctagtgaaacca
gtgtgtctgcccaacccaggcatgatgctggagccagaacagctctgctggatttccggg
tggggggccaccgaggagaaagggaagacctcagaagtgctgaacgctgccaaggtgctt
ctcattgagacacagagatgcaacagcagatatgtctatgacaacctgatcacaccagcc
atgatctgtgccggcttcctgcaggggaacgtcgattcttgccagggtgacagtggaggg
cctctggtcacttcgaagaacaatatctggtggctgataggggatacaagctggggttct
ggctgtgccaaagcttacagaccaggagtgtacgggaatgtgacggtattcacggactgg
atttatcgacaaatgagggcagacagctaa

DBGET integrated database retrieval system