KEGG   Pan troglodytes (chimpanzee): 494186
Entry
494186            CDS       T01005                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04064  NF-kappa B signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04150  mTOR signaling pathway
ptr04210  Apoptosis
ptr04217  Necroptosis
ptr04350  TGF-beta signaling pathway
ptr04380  Osteoclast differentiation
ptr04612  Antigen processing and presentation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04622  RIG-I-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04650  Natural killer cell mediated cytotoxicity
ptr04657  IL-17 signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04940  Type I diabetes mellitus
ptr05010  Alzheimer disease
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05134  Legionellosis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05143  African trypanosomiasis
ptr05144  Malaria
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05205  Proteoglycans in cancer
ptr05310  Asthma
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05410  Hypertrophic cardiomyopathy
ptr05414  Dilated cardiomyopathy
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    494186 (TNF)
   04350 TGF-beta signaling pathway
    494186 (TNF)
   04064 NF-kappa B signaling pathway
    494186 (TNF)
   04668 TNF signaling pathway
    494186 (TNF)
   04071 Sphingolipid signaling pathway
    494186 (TNF)
   04150 mTOR signaling pathway
    494186 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    494186 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    494186 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    494186 (TNF)
   04217 Necroptosis
    494186 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    494186 (TNF)
   04620 Toll-like receptor signaling pathway
    494186 (TNF)
   04621 NOD-like receptor signaling pathway
    494186 (TNF)
   04622 RIG-I-like receptor signaling pathway
    494186 (TNF)
   04625 C-type lectin receptor signaling pathway
    494186 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    494186 (TNF)
   04612 Antigen processing and presentation
    494186 (TNF)
   04660 T cell receptor signaling pathway
    494186 (TNF)
   04657 IL-17 signaling pathway
    494186 (TNF)
   04664 Fc epsilon RI signaling pathway
    494186 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    494186 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    494186 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    494186 (TNF)
  09163 Immune disease
   05310 Asthma
    494186 (TNF)
   05322 Systemic lupus erythematosus
    494186 (TNF)
   05323 Rheumatoid arthritis
    494186 (TNF)
   05321 Inflammatory bowel disease
    494186 (TNF)
   05330 Allograft rejection
    494186 (TNF)
   05332 Graft-versus-host disease
    494186 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    494186 (TNF)
   05014 Amyotrophic lateral sclerosis
    494186 (TNF)
   05020 Prion disease
    494186 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    494186 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    494186 (TNF)
   05410 Hypertrophic cardiomyopathy
    494186 (TNF)
   05414 Dilated cardiomyopathy
    494186 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    494186 (TNF)
   04940 Type I diabetes mellitus
    494186 (TNF)
   04932 Non-alcoholic fatty liver disease
    494186 (TNF)
   04931 Insulin resistance
    494186 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    494186 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    494186 (TNF)
   05135 Yersinia infection
    494186 (TNF)
   05133 Pertussis
    494186 (TNF)
   05134 Legionellosis
    494186 (TNF)
   05152 Tuberculosis
    494186 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    494186 (TNF)
   05170 Human immunodeficiency virus 1 infection
    494186 (TNF)
   05161 Hepatitis B
    494186 (TNF)
   05160 Hepatitis C
    494186 (TNF)
   05171 Coronavirus disease - COVID-19
    494186 (TNF)
   05164 Influenza A
    494186 (TNF)
   05168 Herpes simplex virus 1 infection
    494186 (TNF)
   05163 Human cytomegalovirus infection
    494186 (TNF)
   05169 Epstein-Barr virus infection
    494186 (TNF)
   05165 Human papillomavirus infection
    494186 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    494186 (TNF)
   05144 Malaria
    494186 (TNF)
   05145 Toxoplasmosis
    494186 (TNF)
   05140 Leishmaniasis
    494186 (TNF)
   05142 Chagas disease
    494186 (TNF)
   05143 African trypanosomiasis
    494186 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    494186 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    494186 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    494186 (TNF)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Tumor necrosis fators
   494186 (TNF)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Cytokines
   494186 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 494186
NCBI-ProteinID: NP_001038976
Ensembl: ENSPTRG00000017965
UniProt: Q8HZD9
LinkDB
Position
6
AA seq 232 aa
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAGSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRD
NQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRET
PEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcaggatcatcttct
cgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgaggggcag
ctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgagagat
aaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttcaag
ggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgccgtc
tcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggagacc
ccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttccag
ctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgactttgcc
gagtctggacaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system