KEGG   Pan troglodytes (chimpanzee): 735868
Entry
735868            CDS       T01005                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    735868 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    735868 (KMT5C)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     735868 (KMT5C)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     735868 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 735868
NCBI-ProteinID: XP_016792364
Ensembl: ENSPTRG00000011498
VGNC: 7575
UniProt: H2QH60 A0A663DAM0
LinkDB
Position
19
AA seq 462 aa
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPTLPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLQGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGGEL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggggcccgacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
cccctgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccgctacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgggaggcagatgaggggctgctgagggccggtgagaatgacttc
agcatcatgtactcaacccgcaagcggagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacattgagcctggggacgaggtgacatgcttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgccacacctgtgagaggaaaggtgaagga
gctttccgaaccaggcctagggagcccacgttgccaccacggcccctggacaagtaccag
ctgcgtgagaccaagcggcggctgcagcaaggcctggacagtggcagccgacagggcctg
ctgggccctcgggcctgcgtgcacccatccccgctgcgccgggacccattctgcgccgcc
tgccagcccctgcgcctgccagcctgcagcgcccgcccagacacctcacccctctggctc
cagtggctgcctcagccccagccccgagtgcggccccggaagcgccgacgcccccggccc
cggagggccccagtgctctccacccaccacgctgcccgcgtctccctgcaccgatgggga
ggctgtggcccccactgccgcctgcaaggagaggccctggtggccctgggccagcccccc
cacgcccgctgggcccctcagcaggactggcactgggcccggcgctatgggctgccttac
gtggtgcgtgtggaccttcgtcgcctggccccagccccaccagccaccccagcccctgct
gggaccccaggccccatcctgatcccgaagcaggccctcgcctttgcccccttctcccca
cccaagcgcctacggctggtggtcagccacggctccatcgacctggatgtcggcggtgga
gagctgtga

DBGET integrated database retrieval system