KEGG   Pan troglodytes (chimpanzee): 736459
Entry
736459            CDS       T01005                                 

Gene name
MS4A2
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit beta
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    736459 (MS4A2)
   04071 Sphingolipid signaling pathway
    736459 (MS4A2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    736459 (MS4A2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    736459 (MS4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptr02000]
    736459 (MS4A2)
Transporters [BR:ptr02000]
 Other transporters
  Pores ion channels [TC:1]
   736459 (MS4A2)
SSDB
Motif
Pfam: CD20 TruB-C_2
Other DBs
NCBI-GeneID: 736459
NCBI-ProteinID: XP_024202936
Ensembl: ENSPTRG00000003708
VGNC: 50383
LinkDB
Position
11
AA seq 244 aa
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPQHTWLRVLKKEQEF
LGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGILSIISER
RNATYLVRGSLGANTASSIAGGMGITILIINLKKSLAYIHIHSCQKLFETKCFMASFSTE
IVVMMLFLTILGLGSAVSLTIYGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSP
PIDL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggacacggaaagtaataggagagcaaatcttgctctcccacaagagccttccagtgtg
cctgcatttgaagtcttggaaatatctccccaggaagtatcttcaggcagactgttgaag
tcggcctcatccccaccacagcatacatggctgagagttttgaaaaaagagcaggagttc
ctgggggtaacacaaattctgactgctatgatatgcctttgttttggaacagttgtctgc
tctgtacttgatatttcacacattgagggagacattttttcatcatttaaagcaggttat
ccattctggggagccatatttttttctatttctggaattttgtcaattatatctgaaagg
agaaatgcaacatatctggtgagaggaagcctgggagcaaacactgccagcagcatagct
gggggaatgggaattaccatcctgatcatcaacctgaagaagagcttagcctatatccac
atccacagttgccagaaactttttgagaccaagtgctttatggcttccttttccactgaa
attgtagtgatgatgctgtttctcaccattctgggacttggtagtgctgtgtcactcaca
atctatggagctggggaagaactcaaaggaaacaaggttccagaggatcgtgtttatgaa
gagttaaacatatattcagctacttacagtgagttggaagacccaggggaaatgtctcct
cccattgatttataa

DBGET integrated database retrieval system