KEGG   Pan troglodytes (chimpanzee): 741907
Entry
741907            CDS       T01005                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04145  Phagosome
ptr04151  PI3K-Akt signaling pathway
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04520  Adherens junction
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04972  Pancreatic secretion
ptr05014  Amyotrophic lateral sclerosis
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05100  Bacterial invasion of epithelial cells
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05416  Viral myocarditis
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    741907 (RAC1)
   04014 Ras signaling pathway
    741907 (RAC1)
   04015 Rap1 signaling pathway
    741907 (RAC1)
   04310 Wnt signaling pathway
    741907 (RAC1)
   04370 VEGF signaling pathway
    741907 (RAC1)
   04071 Sphingolipid signaling pathway
    741907 (RAC1)
   04024 cAMP signaling pathway
    741907 (RAC1)
   04151 PI3K-Akt signaling pathway
    741907 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    741907 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    741907 (RAC1)
   04520 Adherens junction
    741907 (RAC1)
   04530 Tight junction
    741907 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    741907 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    741907 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    741907 (RAC1)
   04662 B cell receptor signaling pathway
    741907 (RAC1)
   04664 Fc epsilon RI signaling pathway
    741907 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    741907 (RAC1)
   04670 Leukocyte transendothelial migration
    741907 (RAC1)
   04062 Chemokine signaling pathway
    741907 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    741907 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    741907 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    741907 (RAC1)
   04380 Osteoclast differentiation
    741907 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    741907 (RAC1)
   05205 Proteoglycans in cancer
    741907 (RAC1)
   05203 Viral carcinogenesis
    741907 (RAC1)
   05231 Choline metabolism in cancer
    741907 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    741907 (RAC1)
   05212 Pancreatic cancer
    741907 (RAC1)
   05211 Renal cell carcinoma
    741907 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    741907 (RAC1)
   05020 Prion disease
    741907 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    741907 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    741907 (RAC1)
   05416 Viral myocarditis
    741907 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    741907 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    741907 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    741907 (RAC1)
   05135 Yersinia infection
    741907 (RAC1)
   05100 Bacterial invasion of epithelial cells
    741907 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    741907 (RAC1)
   05163 Human cytomegalovirus infection
    741907 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    741907 (RAC1)
   05169 Epstein-Barr virus infection
    741907 (RAC1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    741907 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    741907 (RAC1)
  Macropinocytosis
   Ras GTPases
    741907 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    741907 (RAC1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   741907 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   741907 (RAC1)
  Exosomal proteins of colorectal cancer cells
   741907 (RAC1)
  Exosomal proteins of bladder cancer cells
   741907 (RAC1)
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    741907 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 741907
NCBI-ProteinID: NP_001233310
Ensembl: ENSPTRG00000018910
UniProt: G2HIC3 A0A6D2W3E5
LinkDB
Position
7
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgatagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatatctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccacct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

KEGG   Pan troglodytes (chimpanzee): 742575
Entry
742575            CDS       T01005                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04510  Focal adhesion
ptr04520  Adherens junction
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04810  Regulation of actin cytoskeleton
ptr05020  Prion disease
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05416  Viral myocarditis
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    742575 (RAC2)
   04014 Ras signaling pathway
    742575 (RAC2)
   04015 Rap1 signaling pathway
    742575 (RAC2)
   04310 Wnt signaling pathway
    742575 (RAC2)
   04370 VEGF signaling pathway
    742575 (RAC2)
   04071 Sphingolipid signaling pathway
    742575 (RAC2)
   04024 cAMP signaling pathway
    742575 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    742575 (RAC2)
   04520 Adherens junction
    742575 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    742575 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    742575 (RAC2)
   04662 B cell receptor signaling pathway
    742575 (RAC2)
   04664 Fc epsilon RI signaling pathway
    742575 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    742575 (RAC2)
   04670 Leukocyte transendothelial migration
    742575 (RAC2)
   04062 Chemokine signaling pathway
    742575 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    742575 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    742575 (RAC2)
   05231 Choline metabolism in cancer
    742575 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    742575 (RAC2)
   05212 Pancreatic cancer
    742575 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    742575 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    742575 (RAC2)
   05416 Viral myocarditis
    742575 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    742575 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    742575 (RAC2)
   05163 Human cytomegalovirus infection
    742575 (RAC2)
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    742575 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 742575
NCBI-ProteinID: XP_016794604
UniProt: K7AGC1 A0A6D2WYU9
LinkDB
Position
22
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRTCSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctatccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccagaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gatgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctagagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcacctgcagcctcctctag

KEGG   Pan troglodytes (chimpanzee): 747131
Entry
747131            CDS       T01005                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3 isoform X1
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04510  Focal adhesion
ptr04520  Adherens junction
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05231  Choline metabolism in cancer
ptr05416  Viral myocarditis
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    747131 (RAC3)
   04014 Ras signaling pathway
    747131 (RAC3)
   04015 Rap1 signaling pathway
    747131 (RAC3)
   04310 Wnt signaling pathway
    747131 (RAC3)
   04370 VEGF signaling pathway
    747131 (RAC3)
   04071 Sphingolipid signaling pathway
    747131 (RAC3)
   04024 cAMP signaling pathway
    747131 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    747131 (RAC3)
   04520 Adherens junction
    747131 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    747131 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    747131 (RAC3)
   04662 B cell receptor signaling pathway
    747131 (RAC3)
   04664 Fc epsilon RI signaling pathway
    747131 (RAC3)
   04062 Chemokine signaling pathway
    747131 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    747131 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    747131 (RAC3)
   05231 Choline metabolism in cancer
    747131 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    747131 (RAC3)
   05212 Pancreatic cancer
    747131 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    747131 (RAC3)
   05416 Viral myocarditis
    747131 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    747131 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    747131 (RAC3)
   05163 Human cytomegalovirus infection
    747131 (RAC3)
GTP-binding proteins [BR:ptr04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    747131 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 747131
NCBI-ProteinID: XP_016786442
VGNC: 51728
LinkDB
Position
17
AA seq 170 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGGLCEIPGVLSPDPAGPEDSV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccactgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctccctggtgagcccggcctccttcgagaacgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcgcccatcacctaccca
cagggcctggccatggcccgggagatcggtgggctctgtgaaatacctggagtgctcagc
cctgacccagcggggcctgaagacagtgtttga

DBGET integrated database retrieval system