KEGG   Pan troglodytes (chimpanzee): 742141
Entry
742141            CDS       T01005                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04120  Ubiquitin mediated proteolysis
ptr04144  Endocytosis
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04625  C-type lectin receptor signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    742141 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    742141 (MDM2)
   04151 PI3K-Akt signaling pathway
    742141 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    742141 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    742141 (MDM2)
   04115 p53 signaling pathway
    742141 (MDM2)
   04218 Cellular senescence
    742141 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    742141 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    742141 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    742141 (MDM2)
   05202 Transcriptional misregulation in cancer
    742141 (MDM2)
   05206 MicroRNAs in cancer
    742141 (MDM2)
   05205 Proteoglycans in cancer
    742141 (MDM2)
   05203 Viral carcinogenesis
    742141 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    742141 (MDM2)
   05220 Chronic myeloid leukemia
    742141 (MDM2)
   05218 Melanoma
    742141 (MDM2)
   05219 Bladder cancer
    742141 (MDM2)
   05215 Prostate cancer
    742141 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    742141 (MDM2)
   05169 Epstein-Barr virus infection
    742141 (MDM2)
   05165 Human papillomavirus infection
    742141 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    742141 (MDM2)
   01522 Endocrine resistance
    742141 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    742141 (MDM2)
   04121 Ubiquitin system [BR:ptr04121]
    742141 (MDM2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     742141 (MDM2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    742141 (MDM2)
Ubiquitin system [BR:ptr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    742141 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 742141
NCBI-ProteinID: XP_001155208
Ensembl: ENSPTRG00000005203
VGNC: 8605
UniProt: H2R792 A0A6D2WGI6
LinkDB
Position
12
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESMESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa
tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtatggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system