KEGG   Pan troglodytes (chimpanzee): 743494
Entry
743494            CDS       T01005                                 

Definition
(RefSeq) T-cell receptor alpha chain V region RL-5
  KO
K10784  T cell receptor alpha chain V region
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04672  Intestinal immune network for IgA production
ptr04940  Type I diabetes mellitus
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05144  Malaria
ptr05150  Staphylococcus aureus infection
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05202  Transcriptional misregulation in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    743494
   04015 Rap1 signaling pathway
    743494
   04064 NF-kappa B signaling pathway
    743494
   04020 Calcium signaling pathway
    743494
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    743494
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    743494
   04660 T cell receptor signaling pathway
    743494
   04658 Th1 and Th2 cell differentiation
    743494
   04659 Th17 cell differentiation
    743494
   04672 Intestinal immune network for IgA production
    743494
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    743494
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    743494
  09163 Immune disease
   05310 Asthma
    743494
   05322 Systemic lupus erythematosus
    743494
   05323 Rheumatoid arthritis
    743494
   05320 Autoimmune thyroid disease
    743494
   05321 Inflammatory bowel disease
    743494
   05330 Allograft rejection
    743494
   05332 Graft-versus-host disease
    743494
  09166 Cardiovascular disease
   05416 Viral myocarditis
    743494
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    743494
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    743494
   05150 Staphylococcus aureus infection
    743494
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    743494
   05170 Human immunodeficiency virus 1 infection
    743494
   05162 Measles
    743494
   05169 Epstein-Barr virus infection
    743494
  09174 Infectious disease: parasitic
   05144 Malaria
    743494
   05142 Chagas disease
    743494
SSDB
Motif
Pfam: V-set I-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 743494
NCBI-ProteinID: XP_001147409
LinkDB
Position
14
AA seq 126 aa
MNYSPGLVSVILLLLGRTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPG
EGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKDSVQASDSAVYFCALSDTVTGTAG
GAEHKL
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaactattctccaggcttagtatctgtgatactcttactgcttggaagaacccgtgga
gattcagtgacccagatggaagggccagtgactctctcagaagaggccttcctgactata
aactgcacgtacacagccacaggatacccttcccttttctggtatgtccaatatcctgga
gaaggcctacagctcctcctgaaagccacgaaggctgatgacaagggaagcaacaaaggt
tttgaagccacataccgtaaagaaaccacttctttccacttggagaaagactcagttcaa
gcgtcagactcagcggtctacttctgtgctctgagtgacacagtgacagggactgcaggg
ggagctgagcacaaactctga

DBGET integrated database retrieval system