KEGG   Pan troglodytes (chimpanzee): 743963
Entry
743963            CDS       T01005                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04672  Intestinal immune network for IgA production
ptr05200  Pathways in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    743963 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    743963 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    743963 (IL5)
   04660 T cell receptor signaling pathway
    743963 (IL5)
   04658 Th1 and Th2 cell differentiation
    743963 (IL5)
   04657 IL-17 signaling pathway
    743963 (IL5)
   04664 Fc epsilon RI signaling pathway
    743963 (IL5)
   04672 Intestinal immune network for IgA production
    743963 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    743963 (IL5)
  09163 Immune disease
   05310 Asthma
    743963 (IL5)
   05320 Autoimmune thyroid disease
    743963 (IL5)
   05321 Inflammatory bowel disease
    743963 (IL5)
   05330 Allograft rejection
    743963 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    743963 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    743963 (IL5)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   743963 (IL5)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Cytokines
   743963 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 743963
NCBI-ProteinID: XP_001163452
Ensembl: ENSPTRG00000017217
VGNC: 13513
UniProt: A0A6D2XJ21 A0A2I3SZB7
LinkDB
Position
5
AA seq 134 aa
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc
cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat
cgaactctgctaatagccaatgagactctgaggattcctgttcctgtacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa
gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc
caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa
gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system