Pan troglodytes (chimpanzee): 743963 Help Entry 743963            CDS       T01005                                  Gene name IL5 Definition (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04630   JAK-STAT signaling pathway ptr04640   Hematopoietic cell lineage ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04660   T cell receptor signaling pathway ptr04664   Fc epsilon RI signaling pathway ptr04672   Intestinal immune network for IgA production ptr05200   Pathways in cancer ptr05310   Asthma ptr05320   Autoimmune thyroid disease ptr05321   Inflammatory bowel disease ptr05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     743963 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     743963 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     743963 (IL5)    04660 T cell receptor signaling pathway     743963 (IL5)    04658 Th1 and Th2 cell differentiation     743963 (IL5)    04657 IL-17 signaling pathway     743963 (IL5)    04664 Fc epsilon RI signaling pathway     743963 (IL5)    04672 Intestinal immune network for IgA production     743963 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     743963 (IL5)   09163 Immune disease    05310 Asthma     743963 (IL5)    05320 Autoimmune thyroid disease     743963 (IL5)    05321 Inflammatory bowel disease     743963 (IL5)    05330 Allograft rejection     743963 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ptr04052]     743963 (IL5)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     743963 (IL5) Cytokines and growth factors [BR:ptr04052]  Cytokines   Interleukins    743963 (IL5) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    743963 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  743963 NCBI-ProteinID:  XP_001163452 Ensembl:  ENSPTRG00000017217 VGNC:  13513 UniProt:  A0A6D2XJ21 A0A2I3SZB7 LinkDB All DBs Position 5 AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ EFLGVMNTEWIIES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat cgaactctgctaatagccaatgagactctgaggattcctgttcctgtacataaaaatcac caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system