KEGG   Pan troglodytes (chimpanzee): 744944
Entry
744944            CDS       T01005                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04014  Ras signaling pathway
ptr04390  Hippo signaling pathway
ptr04392  Hippo signaling pathway - multiple species
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05219  Bladder cancer
ptr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    744944 (RASSF1)
   04390 Hippo signaling pathway
    744944 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    744944 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    744944 (RASSF1)
   05206 MicroRNAs in cancer
    744944 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    744944 (RASSF1)
   05223 Non-small cell lung cancer
    744944 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 744944
NCBI-ProteinID: XP_001168270
Ensembl: ENSPTRG00000014959
VGNC: 7995
UniProt: K7BYY4 A0A6D2X7V4
LinkDB
Position
3
AA seq 340 aa
MSGEPELIELRELAPAGRAGQGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVD
EPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
cagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg
cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctgcctggac
tgttgcgggccccgggacctgggctgggaacccgcggtggagcgggacacgaacgtggac
gagcctgtggagtgggagacacctgacctttctcaagctgagattgagcagaagatcaag
gagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaaggatggttcttac
acaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtgccctccagcaag
aagccaccctccttgcaggatgcccggcggggcccaggacggggcacaagtgtcaggcgc
cgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtgctgtcacgcaca
agggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtggatgacccccgc
aagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttgcggaagctgttg
gatgatgagcagcccctgcggctgcggctcctggcagggcccagtgacaaggccctgagc
ttcgtcctgaaggaaaatgactctggggaggtgaactgggacgccttcagcatgcctgaa
ctacataacttcctgcgtatcctgcagcgggaggaggaggagcacctccgccagatcctg
cagaagtactcctattgccgccagaagatccaagaggccctgcacgcctgcccccttggg
tga

DBGET integrated database retrieval system