KEGG   Pan troglodytes (chimpanzee): 746063Help
Entry
746063            CDS       T01005                                 

Gene name
PARK7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1 isoform X1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    746063 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    746063 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    746063 (PARK7)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     746063 (PARK7)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   746063 (PARK7)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   746063 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 746063
NCBI-ProteinID: XP_001158093
Ensembl: ENSPTRG00000000102
VGNC: 12952
UniProt: A0A2I3SNT8
LinkDB All DBs
Position
1
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggctaaaggagcagaggaaatggagacggtc
atccctgtagatgtcatgaggcgagctgggattaaggtcaccattgcaggcctggctgga
aaagacccagtacagtgtagccgtgatgtggtcatttgtcctgatgccagtcttgaagat
gcaaaaaaagagggaccatatgatgtggtggttctaccaggaggtaatctgggtgcacag
aatttatctgagtctgctgctgtgaaggagatactgaaggagcaggaaaaccggaagggc
ctgatagccgccatctgtgcaggtcctactgctctgttggctcatgaaataggttttgga
agtaaagttacaacacaccctcttgctaaagacaaaatgatgaatggaggtcattacacc
tactctgagaatcgtgtggaaaaagacggcctgattcttacaagccgggggcctgggacc
agcttcgagtttgcgcttgcaattgttgaagccctgaatggcaaggaggtggcagctcaa
gtgaaggctccacttgttcttaaagactag

DBGET integrated database retrieval system