KEGG   Pan troglodytes (chimpanzee): 747093
Entry
747093            CDS       T01005                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04071  Sphingolipid signaling pathway
ptr04115  p53 signaling pathway
ptr04141  Protein processing in endoplasmic reticulum
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04215  Apoptosis - multiple species
ptr04217  Necroptosis
ptr04722  Neurotrophin signaling pathway
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05012  Parkinson disease
ptr05014  Amyotrophic lateral sclerosis
ptr05016  Huntington disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    747093 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    747093 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    747093 (BAX)
   04215 Apoptosis - multiple species
    747093 (BAX)
   04217 Necroptosis
    747093 (BAX)
   04115 p53 signaling pathway
    747093 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    747093 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    747093 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    747093 (BAX)
   05202 Transcriptional misregulation in cancer
    747093 (BAX)
   05203 Viral carcinogenesis
    747093 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    747093 (BAX)
   05212 Pancreatic cancer
    747093 (BAX)
   05225 Hepatocellular carcinoma
    747093 (BAX)
   05226 Gastric cancer
    747093 (BAX)
   05214 Glioma
    747093 (BAX)
   05216 Thyroid cancer
    747093 (BAX)
   05220 Chronic myeloid leukemia
    747093 (BAX)
   05217 Basal cell carcinoma
    747093 (BAX)
   05218 Melanoma
    747093 (BAX)
   05213 Endometrial cancer
    747093 (BAX)
   05224 Breast cancer
    747093 (BAX)
   05222 Small cell lung cancer
    747093 (BAX)
   05223 Non-small cell lung cancer
    747093 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    747093 (BAX)
   05014 Amyotrophic lateral sclerosis
    747093 (BAX)
   05016 Huntington disease
    747093 (BAX)
   05020 Prion disease
    747093 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    747093 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    747093 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    747093 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    747093 (BAX)
   05152 Tuberculosis
    747093 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    747093 (BAX)
   05170 Human immunodeficiency virus 1 infection
    747093 (BAX)
   05161 Hepatitis B
    747093 (BAX)
   05160 Hepatitis C
    747093 (BAX)
   05164 Influenza A
    747093 (BAX)
   05162 Measles
    747093 (BAX)
   05168 Herpes simplex virus 1 infection
    747093 (BAX)
   05163 Human cytomegalovirus infection
    747093 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    747093 (BAX)
   05169 Epstein-Barr virus infection
    747093 (BAX)
   05165 Human papillomavirus infection
    747093 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    747093 (BAX)
   01524 Platinum drug resistance
    747093 (BAX)
   01522 Endocrine resistance
    747093 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptr03029]
    747093 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptr02000]
    747093 (BAX)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    747093 (BAX)
Transporters [BR:ptr02000]
 Other transporters
  Pores ion channels [TC:1]
   747093 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 747093
NCBI-ProteinID: XP_016791969
Ensembl: ENSPTRG00000011267
VGNC: 10275
UniProt: A0A2J8K2C2
LinkDB
Position
19
AA seq 221 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMRGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLMSLSPGRPPLL
LWDAHVADRDHLCGGSAHRLTHHLEEDGLRPPAALDCVFPP
NT seq 666 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgaggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggggctg
cccctggccgagtcactgaagcgactgatgtccctgtctccaggacggcctcctctccta
ctttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtgctcaccgcctc
actcaccatctggaagaagatgggctgaggcccccagctgccttggactgtgtttttcct
ccataa

DBGET integrated database retrieval system