KEGG   Pan troglodytes (chimpanzee): 747442
Entry
747442            CDS       T01005                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04218  Cellular senescence
ptr04310  Wnt signaling pathway
ptr04340  Hedgehog signaling pathway
ptr04371  Apelin signaling pathway
ptr04390  Hippo signaling pathway
ptr04510  Focal adhesion
ptr04530  Tight junction
ptr04630  JAK-STAT signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    747442 (CCND1)
   04340 Hedgehog signaling pathway
    747442 (CCND1)
   04390 Hippo signaling pathway
    747442 (CCND1)
   04371 Apelin signaling pathway
    747442 (CCND1)
   04630 JAK-STAT signaling pathway
    747442 (CCND1)
   04068 FoxO signaling pathway
    747442 (CCND1)
   04151 PI3K-Akt signaling pathway
    747442 (CCND1)
   04152 AMPK signaling pathway
    747442 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    747442 (CCND1)
   04115 p53 signaling pathway
    747442 (CCND1)
   04218 Cellular senescence
    747442 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    747442 (CCND1)
   04530 Tight junction
    747442 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    747442 (CCND1)
   04921 Oxytocin signaling pathway
    747442 (CCND1)
   04919 Thyroid hormone signaling pathway
    747442 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    747442 (CCND1)
   05206 MicroRNAs in cancer
    747442 (CCND1)
   05205 Proteoglycans in cancer
    747442 (CCND1)
   05203 Viral carcinogenesis
    747442 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    747442 (CCND1)
   05212 Pancreatic cancer
    747442 (CCND1)
   05225 Hepatocellular carcinoma
    747442 (CCND1)
   05226 Gastric cancer
    747442 (CCND1)
   05214 Glioma
    747442 (CCND1)
   05216 Thyroid cancer
    747442 (CCND1)
   05221 Acute myeloid leukemia
    747442 (CCND1)
   05220 Chronic myeloid leukemia
    747442 (CCND1)
   05218 Melanoma
    747442 (CCND1)
   05219 Bladder cancer
    747442 (CCND1)
   05215 Prostate cancer
    747442 (CCND1)
   05213 Endometrial cancer
    747442 (CCND1)
   05224 Breast cancer
    747442 (CCND1)
   05222 Small cell lung cancer
    747442 (CCND1)
   05223 Non-small cell lung cancer
    747442 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    747442 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    747442 (CCND1)
   04934 Cushing syndrome
    747442 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    747442 (CCND1)
   05162 Measles
    747442 (CCND1)
   05160 Hepatitis C
    747442 (CCND1)
   05163 Human cytomegalovirus infection
    747442 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    747442 (CCND1)
   05169 Epstein-Barr virus infection
    747442 (CCND1)
   05165 Human papillomavirus infection
    747442 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    747442 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 747442
NCBI-ProteinID: XP_016776923
VGNC: 11283
UniProt: K7CI96 A0A6D2X1Z7
LinkDB
Position
11
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgaaaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc
tccatggtggcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system