KEGG   Pan troglodytes (chimpanzee): 748161
Entry
748161            CDS       T01005                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04144  Endocytosis
ptr04218  Cellular senescence
ptr04310  Wnt signaling pathway
ptr04350  TGF-beta signaling pathway
ptr04371  Apelin signaling pathway
ptr04390  Hippo signaling pathway
ptr04520  Adherens junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04659  Th17 cell differentiation
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    748161 (SMAD3)
   04350 TGF-beta signaling pathway
    748161 (SMAD3)
   04390 Hippo signaling pathway
    748161 (SMAD3)
   04371 Apelin signaling pathway
    748161 (SMAD3)
   04068 FoxO signaling pathway
    748161 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    748161 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    748161 (SMAD3)
   04218 Cellular senescence
    748161 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    748161 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    748161 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    748161 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    748161 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    748161 (SMAD3)
   05212 Pancreatic cancer
    748161 (SMAD3)
   05225 Hepatocellular carcinoma
    748161 (SMAD3)
   05226 Gastric cancer
    748161 (SMAD3)
   05220 Chronic myeloid leukemia
    748161 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    748161 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    748161 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    748161 (SMAD3)
   05161 Hepatitis B
    748161 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 748161
NCBI-ProteinID: XP_001159972
Ensembl: ENSPTRG00000007199
VGNC: 1877
UniProt: H2Q9N8 A0A6D2WIA6
LinkDB
Position
15
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaaaaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccagacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccatccatgactgtggatggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacacggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtccgtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system